CAZyme Information: FPRN_06259-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_06259-t42_1-p1
• CAZy Family: CE9
• CAZyme Description: probable trehalose-6-phosphate phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
883	FCQG01000002|CGC14	99584.56	6.1991

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000002:1655954-1658869(+)

Full Sequence      

MATSSETTGAPNLRRRESLSEIRAANPDLALSGNIISATFNTPHSFVYRKGGDWDLKSRR
GQSALFDSFAYLSSDATPWNHTVVAWTGEIDAPTDDVVSSPGTPAPNTFGATSLNALSAP
VPIDGNARLPTPPPVDGLWVPREDQDRLEYRLSHNKTIRTYPVWLSDESEATSEGILLKD
QARWRRYAEHDLYTLLHYKQHEPTDGRRERVQWADYYRMNQKFANKIIEIYKPGDIVIIH
DYFLMLLPSMLRQRVPNMYISFFLHSPFPSSEFLRCLPRRKEVLEGVLGSNLIGFQSYSY
SRHFLSCCTRILGFPSDTLGIDAYGTRVQVGVFPIGIDAAKVESHAWTDAVTAKYNALRE
LYRGKKIIVGRDRLDSVRGVAQKLQAFERFLEMYPEWRERVVLIQVTSPTSVEAEKEDLE
DDTKVATRVNELVMRINGMYGSLGFSPVQHYPQYLSQNEYFALLRAGDIGLITSVRDGMN
TTSLEYIICQKEGNAPLILSEFSGTAGSLRNAIHINPWDLSGVAEKINAALTMSEDKRQE
MQSRLYRHVTEHNVQSWITKFIRKVYNVLGDSSSANSTPLLDRALLLTQYRSANKRLFMF
DYDGTLTPIVREPSAAVPSERLIHTLDLLASDPKNAVWIISGRDQDFLKQHLGNNRRLGF
SAEHGSFMKHPGSDEWENLAEKFDMGWQAEVMEVFQKYTDRVQGSFIERKRCALTWHYRL
ADPEQGIHMSRECHKELESTVGAKWDVEVMPGKANIEVRPTFINKGEIAKRLITMYHTPS
TESEDKSGHLEFALCMGDDFTDEDMFRSLNAASGPVLDANHVFTVTVGASTKVTLAKSHL
LEPEDVIECVALLAGVQDVGERLGEVNLGALSAVEGHIPNDER

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	30	565	1.9e-154	0.9747368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	136	854	42	724	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	0.0	136	563	42	460	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	5.88e-177	136	567	45	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	7.64e-153	137	568	59	480	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215556	PLN03064	5.50e-143	137	806	143	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT67493.1|GT20	0.0	1	883	1	883
QGI63541.1|GT20	0.0	1	883	1	883
QGI94423.1|GT20	0.0	1	883	1	883
QGI80816.1|GT20	0.0	1	883	1	883
QKD49547.1|GT20	0.0	1	883	1	883

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	1.26e-151	29	562	27	520	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXN_A	5.30e-116	578	853	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	7.90e-111	578	853	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXI_A	5.05e-95	578	856	5	300	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5HUV_A	4.93e-90	137	566	54	468	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	7.41e-226	35	882	16	871	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q9P4D3|TPS2_ZYGRO	1.35e-212	35	882	11	878	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|P78875|TPP1_SCHPO	2.49e-211	29	854	33	813	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|O14145|TPS2_SCHPO	7.13e-161	33	848	7	844	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|Q54K57|TPSA_DICDI	7.29e-150	143	846	68	727	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000010

TMHMM  Annotations     

There is no transmembrane helices in FPRN_06259-t42_1-p1.