CAZyme Information: FPRN_06240-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_06240-t42_1-p1
• CAZy Family: CE8|CE8|CE8|CE8|CE8
• CAZyme Description: related to KRE5-killer toxin-resistance protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1455		161659.53	5.1009

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000002:1722417-1726939(+)

Full Sequence      

MALVAATASLASPSVNVGMNAAFPRAPYLLELLETAAGENSTAYFPLLDKIAGGHFQSAN
SDAELYDRFIKVLEQDGHVTTPDALSTFKLALSLRAAAPRIEAHYQYYSTAVDSVSKGDT
NEDCSTWALIDSKKYCSETLDKAVEGEFSTRQANLLPFDRVLGLGKDAILYADPTSASFG
PFHIALSKAAKQGDMSYRLRYRRSAEAPNTPLSVSGYGVKLDLKRTDYIVIDDREASQEG
KQKPATADVDLDTNEDVADLKPLSTSELASLGLKTASFILNSENPLDALVKSTQDFPKFS
ASIATHEVTKEFAVEQEKNVAAGIPSGINFLWMNGVQLIERQIEPFTLIEMIRRERKLID
GVRDLGFNGQQANSLLGHSEVASSKAEDEPSRFDWTDRLEEGKALLWLNDLEKDARYQKL
PSDLTALLQRTYPGQLPQVALNLFHIVAPVDFTNIEDGRAFGQLAQFMQRGVTLRFGILP
LATTPASAAQAKVVYHLMETYGFESLITYLQESEEGPEGAANKKAFTRAIDGRETLPGAT
KMTLAEILEADTYKQKVEASKAWASRLNADTAVRPVFVNGLAISREKSWVQVMGQRLTED
QQAIQKAVYFGQIEEGTPVSDLFLRDALSKRNTYIFPDDEKSLRVVDVNKLHKDFAGLFS
NIAVLPSDSKASKESWAVLTVVADLGTGDGQDLLLAALKFKRKNPGVRLDLVHNPPSSAE
AHAINGAFKLNEGKLAEMKSKDDLKAILEASWTAEDDGLGTALADFLSASKILPGTKGLL
LNGRVVGPLPSHVSFKEDDLQQLLEFEQRNRILPVYAAIKDLGFEDKLLDPIAAAKLTSI
TALSTISDLPQGIFESAPSIRSSMYNTWNSTHSAIEVGNPETASVHIAGLLNPTSEQGQR
WAPILKVLSELDGVYLKLFMNPKEVVGELPITRFFRYVLDSKPSFDQAGHVQNPKATFKG
LPSEALLTAGMDVPPAWLVAAKESVQDLDNIKLSSVKADIDVIYELENILIEGHSRDGKR
GAPRGAQLTIATEKDPLITDTIVMANLGYFQFKANPGFYNIQLKQGRTSKIFTIESVGAH
GYAPVPGDEGTEIALMDFKGTTLYPRLNRKPGMEEVDVLESPDSEASGIVAKGLKFAESL
LGGAKSPKEISAEEHAEINIFSVASGHLYERMLNIMMVSVMRNTKHTVKFWFIEQFLSPS
FKEFIPYMAAEYGFKYEMVTYKWPHWLRQQKEKQREIWGYKILFLDVLFPLSLDKVIFVD
ADQIVRTDMIDLVNHDLEGAPYGFTPMCDSRTEMEGFRFWKQGYWANYLRGLPYHISALY
VVDLNRFRQLAAGDRLRQQYHALSADPNSLSNLDQDLPNNMQFTIPIHSLPQEWLWCETW
CSDESLAQARTIDLCNNPQTKEPKLDRARRQVPEWSVYDEEIAALNRRRKVVGDMSEKNP
KSRTMEEEVHTKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1158	1405	4.4e-135	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1158	1405	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1158	1425	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	1.95e-88	393	635	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408202	Thioredoxin_15	2.89e-69	647	842	1	204	Thioredoxin-like domain. This is the fourth TRXL(thioredoxin-like) domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	8.59e-61	1012	1120	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT67477.1|GT24	0.0	1	1455	1	1455
QKD49569.1|GT24	0.0	1	1455	10	1464
QGI94407.1|GT24	0.0	77	1455	14	1392
QGI63525.1|GT24	0.0	77	1455	14	1392
QGI80802.1|GT24	0.0	77	1455	14	1392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TRT_A	0.0	11	1451	7	1482	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	11	1451	7	1248	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	0.0	12	1367	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	0.0	11	1451	7	1482	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	11	1451	7	1482	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	3.19e-268	7	1425	14	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	2.62e-232	19	1425	34	1507	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.01e-228	12	1425	44	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	2.65e-227	12	1425	44	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	4.56e-223	12	1425	44	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.978085	0.021966

TMHMM  Annotations     

There is no transmembrane helices in FPRN_06240-t42_1-p1.