CAZyme Information: FPRN_06109-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_06109-t42_1-p1
• CAZy Family: CE8
• CAZyme Description: probable glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768	FCQG01000034|CGC2	86890.00	5.2796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000034:201260-203566(-)

Full Sequence      

MSSFRLLIEDGQFRDGYGRQVVLRGINLAADAKLPSEPDQPSHIPTDFFDGDNVSFHQRP
FPKEDARSHFARLRRYGFNTIRYIFTWEALEAAGPGKYDEDFIQHTIDILRIAKEYGFYI
FMDPHQDVWSRFTGGSGAPLWTIYACGLNPQSFAATEAAIVQNTYPNPDEFPKMIWSTNY
YRLAAGTIFTMFFAGKDFAPKCIIDGVNIQDYLQDHFMRACGQLAQRIHEAGDLEEVVVI
GWESMNEPNKGMTGYKDLTVIPKEHPLKKGTCPTMWQTLLTGMGRACEVDTWEMGGLGPY
KTGTTLVDPHGEVAWLPADYDDSRYGWKRDPGWKLGKCVWAQHGVWDMETDTLLRKDYFA
KNPNTGKVIDYPQFTNTYFMDFWRKYVKTCRAVHKDCIMLMQFPTLELPPEIKGTEDEDP
RMAFTPHYYDGITLMTKHWNSTWNVDVVGVLRGKYWHPALAIRIGETAIRNCLRDQLATL
RQEGLDRIGKHPCVLSEFGIPYDMDDKKAYKTGDYSSQSAAMDANYFAVEGSQIEGHCLW
TYCARNDHLKGDFWNGEDLSILSLDDKPLPESPVPEYSQSSLDLARTATAPNTKKDVADD
RNVTPDNLKRTLTNPSISSAPSAKDPQLTNAPGFRAAEAFVRPTPTVVYGDIVSTGFDLR
QCTYLLKVKAPKAAPDEAPTIVYLPEYHFPKEQCEVAVSSGKWELSTDDEEGTTLQKLKW
WHAEGEQSLKISGLVRKHNVPVGSEEDAGYLEQCQQGYGFNFGSCSVM

Enzyme Prediction     

EC	3.2.1.21:3	3.2.1.45:1	3.2.1.104:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	15	548	4.8e-223	0.9981447124304267

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	7.54e-25	642	731	1	86	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	0.003	77	127	37	88	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI94278.1|GH5_12	0.0	1	768	1	768
QGI63396.1|GH5_12	0.0	1	768	1	768
CCT67355.1|GH5_12	0.0	1	768	1	768
QKD49701.1|GH5_12	0.0	1	768	1	768
CEI69877.1|GH5_12	0.0	1	768	1	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	1.78e-195	13	753	28	784	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
2OSW_A	5.38e-10	14	329	38	289	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	5.38e-10	14	329	38	289	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
6JYZ_A	1.23e-09	5	134	24	134	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
2OSY_A	2.86e-09	14	148	38	161	Chain A, Endoglycoceramidase II [Rhodococcus sp.],2OSY_B Chain B, Endoglycoceramidase II [Rhodococcus sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|H1AE13|EGCR1_ASPFM	0.0	1	768	1	759	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|P40566|EGH1_YEAST	7.43e-182	10	754	10	761	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
sp|I1BTD7|EGCR1_RHIO9	2.52e-105	13	564	22	549	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	4.94e-79	8	701	18	651	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1
sp|Q6L6S1|EGCSE_HYDVU	8.05e-11	9	262	28	245	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FPRN_06109-t42_1-p1.