CAZyme Information: FPRN_05373-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_05373-t42_1-p1
• CAZy Family: CE3
• CAZyme Description: probable b-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		68240.09	6.0637

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000003:57897-59696(-)

Full Sequence      

MLKPQANASRELVSLDGVWNFAVSQSVDIDDERAWERNIPPKLQVPVPASYNDIFVDSSI
RNHVGWVYYQRRFTIPLSWSQQRYFLRFDAATHRGRVFIDDQFVAEHIGGYTPFEVDISD
IVQPGKQVRLTVAVNNELDWHTIPPGRIETLKNGKRKQHYQHDFFNYAGLARSVWLFTVP
SISVKDITVVTKVEGSNGIVDFNIATSIPLDHHSVKVTLLDEDECPVSHSCELNGSLIIK
SVHLWQPGAAYLYQLRAQVFSGNTIVDTYELPVGIRTVEVSGNKFLINGKPFYFTGFGKH
EDTPIRGKGHDPAYMIHDFQLMKWMGANSFRTSHYPYAEEVLDYADRHGIVVINETAAVG
LNLTIVAGLFGHKPIPTFSPETMNDETRAAHSQAIRELIARDKNHPSVVMWTIANEPAAS
EPGVREYMEPLVKLNRELDPTRPICFANENQANIHTDLIADLFDVICLNRYYGWYLNTGD
LEEAEQGLEECLRSWEGKYNKAIIMTEYGADTLAGLHTVGDIPWSEEYQSRVLEMSHRVF
DKVESVVGEQVWNFADFQTPSTFIFRVDGNKKGVFTRDRRPKSAVQVLRKRWTEMEANK

Enzyme Prediction     

EC	3.2.1.31:89

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	591	6.1e-106	0.6156914893617021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	0.0	1	595	1	595	beta-D-glucuronidase; Provisional
225789	LacZ	2.39e-127	1	595	1	598	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	5.55e-99	278	593	1	298	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	4.02e-40	5	556	34	547	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	6.52e-29	14	180	3	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50402.1|GH2	0.0	1	598	1	598
UPK93312.1|GH2	0.0	1	599	1	599
AFM77719.1|GH2	0.0	1	594	1	594
UQC82091.1|GH2	2.93e-295	1	561	1	567
QPC73354.1|GH2	2.26e-291	1	593	1	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C70_A	7.05e-277	1	595	9	600	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	1.41e-275	1	595	34	625	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6LEJ_B	2.14e-232	1	595	1	591	Chain B, Beta-D-glucuronidase [Escherichia coli]
6LEG_A	2.22e-232	1	595	2	592	Chain A, Beta-D-glucuronidase [Escherichia coli],6LEG_B Chain B, Beta-D-glucuronidase [Escherichia coli],6LEG_C Chain C, Beta-D-glucuronidase [Escherichia coli],6LEG_D Chain D, Beta-D-glucuronidase [Escherichia coli],6LEL_A Chain A, Beta-D-glucuronidase [Escherichia coli],6LEL_B Chain B, Beta-D-glucuronidase [Escherichia coli]
3K46_A	2.30e-232	1	595	3	593	Crystal structure of full-length E. coli beta-glucuronidase [Escherichia coli K-12],3K46_B Crystal structure of full-length E. coli beta-glucuronidase [Escherichia coli K-12],3K4D_A Crystal structure of E. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound [Escherichia coli K-12],3K4D_B Crystal structure of E. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound [Escherichia coli K-12],6LEM_A Chain A, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P05804|BGLR_ECOLI	1.10e-231	1	595	1	591	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
sp|P12265|BGLR_MOUSE	2.57e-160	1	592	27	622	Beta-glucuronidase OS=Mus musculus OX=10090 GN=Gusb PE=1 SV=2
sp|O97524|BGLR_FELCA	2.54e-158	1	595	27	628	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|P06760|BGLR_RAT	3.28e-158	1	592	27	622	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1
sp|O18835|BGLR_CANLF	5.08e-158	1	595	27	628	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999946	0.000095

TMHMM  Annotations     

There is no transmembrane helices in FPRN_05373-t42_1-p1.