CAZyme Information: FPRN_05243-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_05243-t42_1-p1
• CAZy Family: CE3
• CAZyme Description: related to beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720	FCQG01000023|CGC7	80677.19	4.7730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000023:244230-246533(+)

Full Sequence      

MFLLFYSFLDIIFHDVSPKHFLANEAENGRRWSNSVIEERALREIYLEPFRIVVEQADPW
CIMTAYNSVNGSFCSESQSLLSILRDEWRYNGAVISDWFGTYSTTDAFNAGLDLEMPGPT
KFREYKKVLEALKRGEVQNKQIKESAARVVDLLRKTGRVGEPGFPPPLKAEEPDYLEDVE
SRPLIRQAVESSMVLLKNEGDTLPLVDRDTRLAVFGHHAIEPSQFGGGSASLKVPYASTP
WEALQKTYRNVTLGAGVAVNRLVPLPNESRLHIDNITLYWYNGDQPSPQQLFHCQELKDT
LYMLVEHAPDGLQDRSDFCTSMNFELVAQKTGPYNLSLSGPGSAKCLLDNRIVLDVERDL
NISTEDFLFDRSKLEVCRQEPVHLEAGRRYKFEVLSWSSKHKAQNVNREFFIQGCRLGLA
LASDDDIALARAENLAETVDTALVVVGTGTEWESEGFDRVSMKLPRRQDELILRVAKACH
GRTIVVVNAGSPIDTSSWIDEVDAVIYAWFPGMEFGNALARIISGDASPCARLPTTFWDT
VGDYPAGNVESLMTSEKEIHYREGIYVGYRQPSLETYSPRFAFGHGLSYSVFSCSVKSPT
NLTFDPIQAAVKVILEVQNTGAVAASETILLFIEASEPTTPRPRVELRTFAKTAILEPGA
SQDLEFCLTAQGFSYWDVTDHLWRVDVGNYKLRVAGPRGVGDWKEIDDVVVRVEGGFTIE

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	18	117	1e-28	0.49074074074074076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	1.83e-47	404	569	53	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	4.78e-33	17	240	164	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.81e-28	17	677	206	734	beta-glucosidase BglX.
178629	PLN03080	1.36e-22	19	603	215	648	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.73e-15	19	152	170	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT66579.1|GH3	0.0	17	720	143	846
QGI93649.1|GH3	0.0	17	720	158	861
QGI62759.1|GH3	0.0	17	720	158	861
QKD50590.1|GH3	0.0	17	720	143	846
CEF86475.1|GH3	0.0	17	719	144	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.11e-99	19	695	146	822	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.16e-97	19	695	146	822	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.53e-60	19	695	152	654	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.47e-56	19	695	163	699	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.81e-55	19	695	163	699	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DPG0|BGLH_NEOFI	3.67e-102	19	695	147	806	Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglH PE=3 SV=1
sp|A1CUR8|BGLH_ASPCL	1.40e-101	19	720	147	821	Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglH PE=3 SV=1
sp|B0XM94|BGLH_ASPFC	5.50e-100	19	695	147	806	Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglH PE=3 SV=1
sp|Q4WL79|BGLH_ASPFU	2.91e-99	19	695	147	806	Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglH PE=3 SV=1
sp|P27034|BGLS_RHIRD	4.49e-99	19	695	143	796	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.789357	0.210660

TMHMM  Annotations     

There is no transmembrane helices in FPRN_05243-t42_1-p1.