CAZyme Information: FPRN_05178-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_05178-t42_1-p1
• CAZy Family: CE16
• CAZyme Description: related to alpha-L-arabinofuranosidase A precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660	FCQG01000023|CGC5	73028.59	8.5777

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000023:401837-404020(+)

Full Sequence      

MVRFSSILTAAACFVAVESVNIKVDSKGGNATSGHQYGFLHEDINNSGDGGIYAELIRNR
AFQYSKKYPVSLSGWRSINDAKLSLNRLDTPLSDALPVSMNVKPGKSKSKEIGFLNEGYW
GMDVKKQKYTGSFWVKGAYKGHFTASLRSNLTDDVFGSVKVKSKANKKQWVEHEFVLTPN
KNAPNSNNTFAITYDPKGADGALDFNLISLFPPTYKGRKNGLRVDLAEALEGLHPSLLRF
PGGNMLEGNTNKTWWDWKDTLGPLRNRPGFEGVWNYQQTHGLGILEYLQWAEDMNLEIIV
GVYAGLSLDGSVTPKDQLQPLIDDALDEIEFIRGPVTSKWGKKRAELGHPKPFRLSYVEV
GNEDWLAGYPTGWNSYKEYRFPMFLDAIKKAHPDLTVISSGASIDPVGKTDAGFDIPAPG
IGDYHPYREPDVLVEEFNLFDNNKYGHIIGEVASTHPNGGTGWSGNLMPYPWWISGVGEA
VALCGYERNADRIPGTFYAPILKNENRWQWAITMIQFAADSAMTTRSTSWYVWSLFAGHP
MTHTLPATSNFDPLYYVAGKNEDKGTLIWKGAAYNTTKGADVPVSLSFKGVKPGAQAELT
LLTNKEKDPFAFNDPHKGNNVVDTKKTVLKADGKGAFNFKLPNLSVAVLETLKKGKPYSS

Enzyme Prediction     

EC	3.2.1.55:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	206	652	3.4e-68	0.6761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214830	Alpha-L-AF_C	6.93e-32	465	645	12	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
226064	AbfA	7.75e-26	209	365	37	175	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
399741	Alpha-L-AF_C	1.88e-19	450	645	1	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI62710.1|GH51	0.0	1	660	1	660
CCT66517.1|GH51	0.0	1	660	1	660
QGI79876.1|GH51	0.0	1	660	1	660
QGI93602.1|GH51	0.0	1	660	1	655
QKD50651.1|GH51	0.0	1	660	1	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	1.50e-105	20	649	1	622	Chain AAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
6ZTA_A	2.65e-07	220	368	50	181	Chain A, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZTA_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZTA_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus]
2VRQ_A	4.62e-07	220	368	50	181	Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_B Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_C Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus]
6ZT6_A	8.05e-07	220	368	50	181	Chain A, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT6_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT6_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_A Chain A, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus]
6ZT8_A	8.05e-07	220	368	50	181	Chain A, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT8_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT8_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT9_A Chain A, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT9_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT9_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|U6A629|ABFA_PENCN	8.06e-196	19	651	17	630	Alpha-L-arabinofuranosidase A OS=Penicillium canescens OX=5083 GN=abfA PE=1 SV=1
sp|Q0CTV2|ABFA_ASPTN	5.10e-129	1	649	1	625	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1
sp|B8NKA3|ABFA_ASPFN	1.27e-126	17	649	23	626	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2
sp|Q2U790|ABFA_ASPOR	1.27e-126	17	649	23	626	Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=abfA PE=3 SV=2
sp|Q96X54|ABFA_ASPAW	4.79e-119	1	649	1	625	Probable alpha-L-arabinofuranosidase A OS=Aspergillus awamori OX=105351 GN=abfA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999778	CS pos: 19-20. Pr: 0.9681

TMHMM  Annotations     

There is no transmembrane helices in FPRN_05178-t42_1-p1.