CAZyme Information: FPRN_05025-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_05025-t42_1-p1
• CAZy Family: CE1
• CAZyme Description: probable beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
893		96295.34	4.9908

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000068:16097-19302(+)

Full Sequence      

MKLNWVAAALSVGAAGTDSAVALASAVPDTLAGVKVVTRDTLAYSPPHYPSPWMDPNAIG
WEEAYAKAKNFVSQLTLLEKVNLTTGVGWQGERCVGNVGSIPRLGMRGLCLQDGPLGIRL
SDYNSAFPAGTTAGASWSKSLWYERGLLMGTEFKEKGIDIALGPATGPLGRTAAGGRNWE
GFTVDPYMAGHAMAEAVKGIQDAGVIACAKHYIANEQEHFRQSGEVQSRKYNISESLSSN
LDDKTMHELYAWPFADAVRAGVGSVMCSYNQINNSYGCQNSKLLNGILKDEMGFQGFVMS
DWAAQHTGAASAVAGLDMSMPGDTAFDSGYSFWGGNLTLAVINGTVPAWRVDDMALRIMS
AFFKVGKTVEDLPDINFSSWTRDTFGFVHTFAQENREQVNFGVNVQHDHKSHIREAAAKG
SVVLKNTGSLPLNNPKFLAVIGEDAGPNPAGPNGCGDRGCDNGTLAMAWGSGTSQFPYLI
TPDQGLQNRAAQDGTRYESILTNNEWASVQALVSQPNVTAIVFANADSGEGYIEVDGNFG
DRKNLTLWQQGDELIKNVSSICPNTIVVLHTVGPVLLADYEKNPNITAIVWAGLPGQESG
NAIADLLYGKVSPGRSPFTWGRTRESYGTEVLYEANNGRGAPQDDFSEGVFIDYRHFDRR
SPSTDGKSSPNNTAAPLYEFGHGLSWTTFEYSDLNIQKNVENAYSPATGQTIPAPTFGNF
SKNLNDYVFPKGVRYIYKFIYPFLNTSSSASEASNDGGQFGKTAEEFLPPNALNGSAQPR
LPSSGAPGGNPQLWDILYTVTATITNTGNATSDEIPQLYVSLGGENEPVRVLRGFDRIEN
IAPGQSAIFNAQLTRRDLSNWDVNSQNWVITDHPKTVWVGSSSRKLPLSAKLE

Enzyme Prediction     

EC	3.2.1.21:43	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	100	321	3.6e-57	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	5.23e-53	422	654	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	7.01e-40	101	469	55	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	5.95e-31	66	692	51	639	Probable beta-xylosidase; Provisional
185053	PRK15098	2.09e-30	127	696	120	658	beta-glucosidase BglX.
395747	Glyco_hydro_3	2.07e-29	112	361	74	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT66374.1|GH3	0.0	1	893	1	893
QGI93464.1|GH3	0.0	1	893	1	921
QGI62571.1|GH3	0.0	1	893	1	921
QGI79735.1|GH3	0.0	1	893	1	921
QKD50807.1|GH3	0.0	1	893	1	893

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SZ6_A	0.0	43	892	2	835	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJI_A	0.0	42	892	3	840	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5FJJ_A	0.0	39	892	1	838	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5JU6_A	0.0	31	893	11	852	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5NBS_A	0.0	37	892	12	856	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CTD7|BGLA_ASPTN	0.0	36	892	17	857	Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglA PE=3 SV=1
sp|Q4WJJ3|BGLA_ASPFU	0.0	42	892	32	869	Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglA PE=1 SV=1
sp|B0XPE1|BGLA_ASPFC	0.0	42	892	32	869	Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglA PE=3 SV=1
sp|Q5B5S8|BGLA_EMENI	0.0	1	892	1	859	Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglA PE=3 SV=2
sp|P87076|BGLA_ASPKW	0.0	31	892	11	856	Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.031147	0.968818	CS pos: 24-25. Pr: 0.5775

TMHMM  Annotations     

There is no transmembrane helices in FPRN_05025-t42_1-p1.