CAZyme Information: FPRN_04567-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_04567-t42_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: related to protein kinase C pathway protein SMP3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	FCQG01000074|CGC1	58758.71	9.7916

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000074:32985-34793(+)

Full Sequence      

MWRRTYLTLVLIRLWFALSPSYLHPDENFQGPEVIAGQIFSYPVRHTWEFTSENPIRSVF
PLWPVYGLPMLLLRWLWIGNGKDGEIPPIAVFWTLRVLMFVISFVLEDWALHELIPSPKH
RRVAVLLVASSYVTWTYQTHTFSNSVETLVVAWSLVLIQRVADPRQRSCVLSATVLGIVG
VFGVFNRITFPAFLVVPGLRLLPVFWKRPTSLVYLTLAAALTTVIAIGLDTAFYLPGPIT
WTDLIHKPIITPLNNFKYNSATENLAQHGLHPWYQHLVGNLPLLLGPAAALLIARPKISI
RLWSAVSGLVVLSAFQHQEARFLLPTVPLFLSSIRMPRNQTILYVFTAVWIGFNLVLGSL
MGIYHQGGVVPGQVFLSQQPDATQAVWWRTYTPPIWLLNGKNEFLTTRDVMGLKGEVLLE
QLYGLATCDTPADRRNQEYLKEKNGTYLIAPASATWLDPYLPNKGLEGLRFREVWRYRKH
LNLDDLDFGDDGVWDTLARVIGRRGLVAWRVTKSCPN

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	397	1.1e-78	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	1.62e-44	5	371	2	372	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI93033.1|GT22	0.0	1	517	1	517
QGI79306.1|GT22	0.0	1	517	1	517
QGI62138.1|GT22	0.0	1	517	1	517
CCT65953.1|GT22	0.0	1	517	1	516
QKD51275.1|GT22	0.0	1	517	1	517

PDB Hits     

FPRN_04567-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	0.0	1	517	1	517	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q4WTT7|SMP3_ASPFU	1.20e-180	1	514	1	544	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	4.23e-180	1	517	1	543	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q5BAX7|SMP3_EMENI	3.84e-166	1	509	1	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	6.96e-100	10	487	13	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.065658	0.934308	CS pos: 23-24. Pr: 0.7640

TMHMM  Annotations     

Start	End
59	78
89	111
123	142
177	199
212	234
272	294
342	364