CAZyme Information: FPRN_04032-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_04032-t42_1-p1
• CAZy Family: CBM508|CBM508
• CAZyme Description: related to beta-hexosaminidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693		73967.22	4.3070

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000013:91437-94249(-)

Full Sequence      

MQGAPPHGKLDSRPHGGYYSREDLEELVAFATERHIRVVPEIDMPGHMQAAVAAYPELGN
GAQVVVMEEWGISKHVLNMSDKALEFCKDVLDTVCDIFPSEFIGIGGDECPHDEWKANPD
IQSKMEHLGLANEAALHEWFIGQMAAHLHVHGRRPYGWDELMGCGDKVPKDVLIAAWRGI
EPTEIAAKRGFQVIACPDIKCYLDYRQSEDKNEPTPVGIVLPLEDIYNFDPVPEGLTQDE
KKKVVGTQVNVWTEHMESASRVDYMVFPRLCAFAEVAWGKADNHSDIGDFKVRLEQHLPR
LEALGVNYRQLSGPRPWNARPDAPATTTTATTTESLGLSSTLSTDATKATEQSDSTTTTT
LAISESTISSAVGSSALLSDTTALSDQTELTATTTIAVSESTSVTDLGSTTSVASSDISV
PTSTEVTSTAVSVSSISTSVLSTSDKLTSSVDASVTTSAPASTTTTVESAGTTEPTTTAE
STTDSTAVSSTQISTDTTLEATTTTTTEAPTSTTIVEEVSTTTTLLPIPTLFTLSAQGGP
ADGLVIHGNGLPEYSVWIGAFLAWPTGLFKYEEGTGHASVDGNPLCALSYQGNFDFVSVI
VCPTTLQFYHAPLVCDRPTDGSLKCSVAVKLYNCVTSNGGTRTCTTTDASWSDMYSSAPL
YATSGTYYQLRFAAADWAHDSQVSPIGLTVTPV

Enzyme Prediction     

EC	3.2.1.52:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	12	280	1e-82	0.7833827893175074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119333	GH20_chitobiase-like	2.46e-124	5	294	69	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
395590	Glyco_hydro_20	2.31e-104	9	278	65	343	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
226056	Chb	6.85e-65	3	324	328	653	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
119338	GH20_chitobiase-like_1	9.02e-51	15	294	61	311	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
119336	GH20_SpHex_like	3.04e-49	16	294	69	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI82557.1|GH20|GH93	0.0	1	693	553	1244
QGI65309.1|GH20	0.0	1	693	178	858
QGI96190.1|GH20|GH93	2.06e-269	1	553	553	1104
CCT69480.1|GH20	4.20e-230	1	324	195	518
UNI23976.1|GH20	2.08e-141	1	324	165	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RCN_A	1.69e-98	8	321	210	526	Crystal Structure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
6Q63_A	9.49e-68	8	308	230	536	BT0459 [Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7CBN_A	5.22e-65	9	324	203	521	Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
6EZR_A	4.73e-53	5	317	332	641	Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	5.60e-52	5	317	329	638	Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2UQG6|H0868_AKKM8	3.42e-64	9	324	222	540	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
sp|P49008|HEXA_PORGI	2.86e-56	11	308	235	532	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
sp|P96155|HEX1_VIBFU	6.69e-39	6	274	329	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
sp|B2UP57|H2018_AKKM8	9.83e-30	11	278	178	447	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
sp|Q7WUL4|HEX20_CELFI	7.01e-25	10	319	183	491	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FPRN_04032-t42_1-p1.