CAZyme Information: FPRN_03524-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_03524-t42_1-p1
• CAZy Family: AA7
• CAZyme Description: related to beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
858		95359.78	5.6355

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000042:250803-253674(+)

Full Sequence      

MNDSNTPSTPDTEYSAPCSPQQKIQHLRDTRSAAREKLARLTLVSLLTAADFWRTKAIPE
KGIPSIKTTDGPNGARGGIFVGGTKAALFPCGISLAATWNKDLLYQVGQHLALEVRARSA
EMLLAPTVCMHRHPLGGRNFESFSEDPLLTGKLAAQYIKGLQDRGVAATIKHFVGNEQET
NRLTIDSLITERPLREIYLKPFEIAIREANPWAVMTSYNLINGVHADLNKHTLKDILRGE
WGYEGTVVSDWGGINSSIESVEAGCDIEFPYSSKWRLDKLVTAVNEGRISIEDINQAAEN
VLTLVERLKGGDMSPEAPEREDDREETRELIRTAGHEGLTLLKNDGGILPLCPRSTKVAV
IGPNANRHIAGGGGSASLNPYYNTIPLDSIRKASKQKVSFAQGCHIHKWLPVASEYCTEQ
SGKPGVHIDWYAGDKFEGNPVVKQRRTNTDLFLWDSAPLSEVGPEWSAVATTFLMPRTTG
KHTISFMSVGPGKLFINDKLVLDLWDWTEEGEAMFDGSIDYLVDVDMEADKAVELRVEMT
NELRPISKQKQFGITHKYGGCRIGYKEQDQVDYIQQAVQTARDADVAVVIVGVDAEWESE
GYDRQTMDLPADGNQDRLIEAVVKANPKTVVVNQSGSPVHMPWVDRVPVILQGWYQGQEA
GNALADVLFGIENPSGKLPSTFPKRIEHTPAWHTWPGENHKVLYGEGLYIGYRHYDHAKI
EPLFPFGHGLSYTTFEYGRPEISTKTLTPDGEIKITLAVSNIGTRAGAEIVQLYVHDEKS
RLPRPEKELVAFEKVFLEAEETRHITIKLDKYAVGYYDETVPGWIAEEGAFKVLIGASST
DIRQSTRFNVKESFTWVF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	57	269	9.5e-71	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.13e-94	89	849	120	763	beta-glucosidase BglX.
224389	BglX	4.65e-78	51	376	48	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.73e-60	339	712	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.32e-51	62	304	65	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.72e-49	42	810	55	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI78386.1|GH3	0.0	1	858	1	858
QGI61209.1|GH3	0.0	1	858	1	858
CCT64887.1|GH3	0.0	1	858	1	858
QGI92108.1|GH3	0.0	1	858	1	858
QKD53598.1|GH3	0.0	1	843	1	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.41e-185	44	856	19	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	7.28e-181	44	856	19	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.22e-151	46	855	20	679	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.24e-119	45	842	19	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.02e-113	55	852	43	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	9.40e-218	38	842	15	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1DNN8|BGLJ_NEOFI	1.23e-205	44	833	27	838	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|P27034|BGLS_RHIRD	1.03e-200	44	850	15	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	7.02e-199	44	833	27	839	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	1.98e-198	44	833	27	839	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999038	0.000970

TMHMM  Annotations     

There is no transmembrane helices in FPRN_03524-t42_1-p1.