CAZyme Information: FPRN_02068-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_02068-t42_1-p1
• CAZy Family: AA7
• CAZyme Description: related to exopolygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	FCQG01000043|CGC2	49959.10	5.8823

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000043:11391-13010(-)

Full Sequence      

MLFNNLVSAVAVSALVSSVVGTSSRNSALPKRPHVEAAPYGTGKAFPASPARSRKDFCYV
NAGKGKNVDDASSILKAFKKCNKGGTIVLDQKYSIASPLDLTWLAHVDVIITGEVNFKSD
PYYWADHSFKYDFQNMSSFWKIGGKDIHIYGDLTKGESVLDGHGQAYWEEMAVNKTLLRP
ILLTIEDAHGLTISNLRMRNPPNWFNIIINSTDVLISDLDLEAKSLNGVKIANSDGWDTY
RSDRIVIQDSVINNTDDCVSFKPNSTNVVVQNLVCNGSHGISVGSLGQYKGETDIVENLY
IYNISMSNASDGARIKVWPGVETAFQDLLNGGGGLGRVRNVTYDTFYHENNDNAITITQC
YGQKNQTLCNEFPANLTIEDVTMKNFWGTVSTKYDPRAGTLVCSAPDRCSNIVAEDIRVQ
VPSKKPPVYDCQNIDTSTLDITCRDPTSARDTTNG

Enzyme Prediction     

EC	3.2.1.67:7	3.2.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	82	437	7.9e-73	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.03e-32	144	436	43	317	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	3.81e-27	149	440	138	395	polygalacturonase
178580	PLN03003	1.12e-24	140	423	99	361	Probable polygalacturonase At3g15720
215426	PLN02793	1.13e-23	47	419	43	394	Probable polygalacturonase
215120	PLN02188	1.01e-22	228	434	193	390	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT63542.1|GH28	0.0	1	455	1	455
BAE97163.1|GH28	0.0	1	455	1	455
BAE97166.1|GH28	0.0	1	455	1	455
BAE97143.1|GH28	0.0	1	455	1	455
BAE97165.1|GH28	0.0	1	455	1	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	2.59e-66	58	443	19	382	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	7.55e-21	142	407	66	311	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1NHC_A	2.03e-18	86	390	6	292	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
6KVE_A	7.36e-18	70	392	15	302	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	9.92e-18	70	392	15	302	Chain A, endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CGP0|PGLRX_ASPTN	1.13e-149	39	443	34	431	Probable exopolygalacturonase X OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgaX PE=3 SV=1
sp|Q4WCZ8|PGLRX_ASPFU	6.03e-149	47	443	40	431	Probable exopolygalacturonase X OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pgaX PE=3 SV=2
sp|B0YDE8|PGLRX_ASPFC	6.03e-149	47	443	40	431	Probable exopolygalacturonase X OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pgaX PE=3 SV=2
sp|A1DLC1|PGLRX_NEOFI	2.43e-148	47	443	40	431	Probable exopolygalacturonase X OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgaX PE=3 SV=2
sp|Q5ASG9|PGLX1_EMENI	3.92e-145	6	443	7	431	Exopolygalacturonase X-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgaX-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.096273	0.903705	CS pos: 21-22. Pr: 0.8644

TMHMM  Annotations     

There is no transmembrane helices in FPRN_02068-t42_1-p1.