CAZyme Information: FPRN_02001-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_02001-t42_1-p1
• CAZy Family: AA5
• CAZyme Description: related to small s protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1142	FCQG01000001|CGC4	127411.90	7.2817

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000001:2099528-2103943(-)

Full Sequence      

MRLLDVFVAVVAFLPTSFAALPTQAEGFAAGTTGGKGGQVVRPKNNQELTNYLKDNTARI
IYLERTFDFKGSEGSATETGCAPWGTGTHCQLSINKNQWCTNYNPGAQKVTVKYDKAGLN
PLMVGSNKSIIGVGSKGVIKGKGLRLANGVKNVIIQNIHITDLNPSLVWGGDAITLDGTD
NIWIDHCTTSLIGRQHIVLGTGASGRVSITNNKIDGVSPWSASCNTYHYWAILFLGKSDL
ITFKGNYMYHVSGRAPKVSGNTLLHVVNNYFHDVFDHAFEIEENGQVLAEGNAFQNVKNP
LKTGTKGRLFTVPTAGSASSCKAALGRACQMNAFGSSGAFPGDDTGFLGSFKGKTIASAA
SAQRAKNAMTEAGFGLADKQKFEVLIQYLAELTTKLDQVVPPSSSEIARSMIQSDIELIK
KDVRKLLLFQEAAGNHTAIAQSTEENLDIMRQARILNTLWFRMINDRSESISKNHRDTLQ
WAIEGSNNTESWHDLPSWLLNGSGIYWVSGKAGSGKSTLMKFVFGHQRTTSILSQWANGG
RVLTCHYFFSNLGTDLQKSQAGLSRTLIYQILDKNRSLIQEALPNMWKELLERESSLREK
DVVMHENITLPSVAETRQAFELISANSGRIGHICFFIDGLDEPVGDYRDSIDFISKLAHN
EQSKVVVSSRPIPTCVAAFQKHPQMKLQDLTRHDIQAYVQFKVGSHPSMKRYMRRYPEES
ASLLNELVDKSFGVWLWIILACRSICGGFDDHDRLSEIRRRVDELPPELKDMFMHMLSKV
HRRHQRQGAQLLKICYTYQKTKSLFLQKGLYALGLALVDDYNTQTVCIKNLDAEEKLEIC
EELEGRLRSRCWGLLEFADFKPATSGRDITESKVIFMHRTVFEFLSDQNTWKLDCLQIRD
LNFESATALSLYGAHMAVQKLGEYNEVAAMDLLEEGLWWGAEADKQRPSDTNNCFFHLTA
FLSLLSERRPSCDTLQLQRLAQALNAGELSDRSHTDECPPTSLLLAVEAGATNFVKSHSS
FTTTNHDCQRGCRPLLYHALRKPFLSDKFNDHPSLSRFSTSHMVEMLLLMGCDATDLVAI
SGWETSLWSLWLEELTRLTTYTLNEDEKAVLANISQMFRAANQNFRPEGFDDMIIGWPSV
AY

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	111	296	2.2e-87	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	9.04e-59	109	298	1	190	Amb_all domain.
226384	PelB	1.73e-21	66	301	28	280	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.56e-20	115	294	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
405210	HeLo	4.59e-08	376	426	117	166	Prion-inhibition and propagation. This N-terminal region, HeLo, has a prion-inhibitory effect in cis on its own prion-forming domain (PFD) and in trans on HET-s prion propagation. The domain is found exclusively in the fungal kingdom. Its structure, as it occurs in the HET-s/HET-S proteins, consists of two bundles of alpha-helices that pack into a single globular domain. The domain boundary determined from its structure and from protease-resistance experiments overlaps with the C-terminal prion-forming domain of HET-s (PF11558. The HeLo domains of HET-s and HET-S are very similar and their few differences (and not the prion-forming domains) determine the compatibility-phenotype of the fungi in which the proteins are expressed. The mechanism of the HeLo domain-function in heterokaryon-incompatibility is still under investigation, however the HeLo domain is found in similar protein architectures as other cell death and apoptosis-inducing domains. The only other HeLo protein to which a function has been associated is LopB from L. maculans. Although its specific role in L. maculans is unknown, LopB- mutants have impaired ability to form lesions on oilseed rape. The HeLo domain is not related to the HET domain (PF06985) which is another domain involved in heterokaryon incompatibility.
404168	Beta_helix	4.14e-04	172	296	1	112	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI59750.1|PL1_4	4.92e-266	1	377	1	377
CCT63296.1|PL1_4	4.92e-266	1	377	1	377
QGI76951.1|PL1_4	4.92e-266	1	377	1	377
QGI90665.1|PL1_4	4.92e-266	1	377	1	377
QKD46500.1|PL1_4	4.13e-262	1	377	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.17e-131	25	359	7	341	Pectin Lyase B [Aspergillus niger]
1IDK_A	6.31e-131	24	375	6	357	Pectin Lyase A [Aspergillus niger]
1IDJ_A	4.78e-130	24	375	6	357	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
3VMV_A	4.30e-13	26	297	5	249	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1VBL_A	1.85e-10	26	294	12	330	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WV10|PELA_ASPFU	3.07e-137	1	370	1	372	Probable pectin lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelA PE=3 SV=1
sp|Q5BA61|PELB_EMENI	2.26e-136	16	375	17	377	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|B0XT36|PELA_ASPFC	6.44e-135	25	361	25	361	Probable pectin lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelA PE=3 SV=1
sp|Q4WIS6|PELB_ASPFU	6.44e-135	25	361	25	361	Probable pectin lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelB PE=3 SV=1
sp|Q0CYL8|PELA_ASPTN	9.62e-134	25	375	26	376	Probable pectin lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999742	CS pos: 19-20. Pr: 0.9762

TMHMM  Annotations     

There is no transmembrane helices in FPRN_02001-t42_1-p1.