CAZyme Information: FPRN_01973-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_01973-t42_1-p1
• CAZy Family: AA5
• CAZyme Description: probable sterol glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849		91611.57	8.1069

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000001:2031486-2034282(-)

Full Sequence      

MSPTPDDDRSNRQTRYFELPANGEHSAQLPDELPPYQALAELEATTTGREDGRIDIDLSS
RIARRLSKLVPTGKPPISHGQNQPPAYTETSEKSIRLNIVIQVVGSRGDVQPFVALGTEL
QRHGHRVRLATHGQFDKFVRESGLEFFSIGGDPAELMAYMVKNPGLFPSMKTLRGGEIQR
KRKMVDEMLHKCWSSCIEPDELTGRPFVADAIIANPPSFAHIHCAQALGIPLHLMFTMPW
TSTREFCHPLANLKANGSDMSATAANYVSYSLVEWMTWQGLGDIINAWRDTIDLEPIPFS
EGPCLTETLGVPVTYCWSPALVPKPADWPENIDVCGFFFRDAPKYQPEPALQQFLSSGPP
PIYIGFGSIVIDDPDKLTATILDAVRATGTRAIVSRGWSKLGGDSPGDDQVFFLGDCPHE
WLFQHVTAVIHHGGAGTTACGLLNAKPTTIVPFFGDQPFWGNMVHAGGAGPAPIPFKALN
SSNFAKAILFCLTPEASAAARQIADKMSCEAGVRRAVASFHANLPLNAMRCDLLPNHSAA
WMYDKKGKKIKLSKIAAELLVEDEKVSWNNLKAYQPQPVHIENRRWDPVTATLATLATTS
VGMVTSAFDIVVKPIQALRPVTPSGSRSASRDRSGNNSKRPSEEDVFGRPAGIDLSSAPT
ATKDKDPNHGALAAVKGSASGVGGFFKHYSKGMLLDLPYAVTEGMRNAPKLYGGKAYDPG
AVTDWKSGGIAAGKNFAHGMVEGIGGIVMEPVRGAKKEGAAGAAKGVGIGLLNLGTKVGS
GALGLFALPSQGAYMSARALVKRKTGKGIMEARKIEGRDVVERSDGETRRKDRMVVVEEF
GALMGENTR

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	122	520	6e-53	0.9633507853403142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.23e-80	97	522	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.75e-41	99	522	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	6.38e-24	99	246	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	4.99e-05	357	516	223	382	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI59725.1|GT1	0.0	1	849	1	855
QGI76927.1|GT1	0.0	1	849	1	855
QGI90640.1|GT1	0.0	1	849	1	855
QKD46522.1|GT1	0.0	1	846	1	849
CCT63268.1|GT1	0.0	1	849	1	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GL5_A	3.89e-71	67	524	12	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
5XVM_A	3.17e-70	85	524	8	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
1IIR_A	1.58e-32	97	504	1	379	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	6.10e-28	97	504	1	362	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	3.32e-20	97	504	1	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	4.94e-127	49	525	111	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.19e-123	97	525	193	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|A1CYS1|ATG26_NEOFI	4.70e-72	97	524	911	1328	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
sp|P0CN90|ATG26_CRYNJ	5.70e-72	97	524	1034	1463	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|P0CN91|ATG26_CRYNB	5.70e-72	97	524	1034	1463	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FPRN_01973-t42_1-p1.