CAZyme Information: FPRN_01731-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_01731-t42_1-p1
• CAZy Family: AA3
• CAZyme Description: probable galactose oxidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1070	FCQG01000001|CGC10	113730.02	9.2413

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000001:1390584-1393796(-)

Full Sequence      

MKVVYALSLCLGIADAVVLPVFSAPKGGYALPRPDSDDTTDTSKTLAGSSKTNLNSVLPV
FGNAKPKSGFPASALSRRVERIEQTYGSGDESTDDSDYTPTEPSDATPLSPSHDTPSGSS
DDVQEVVYAEPFMQPTYVRFGPAPVDKPEVAPKAKSKSKDTASVAKHGGDDDSSSGGHKQ
KGKDKNKGNDDKGRHNGDDDATKSRKKPEDSPKTSSSSATDSVSVTATSTAAPTSSPTGD
DKGKGKGKGKGKGKDDGGRHHGDDDATKSRTRVDDSKTRSSASPTATASSKKGSSGKHSG
EDDGGKSRAKAEDSKANAKKASKKTSKSKPSKKSFITHQSGKTFDADSTKGGGKNGPGYN
PSFDIPKLNKGYVQAIPPKASTLNNKFSSRVKPRPQLSAEKVRPLSSSSSSSSSSPLKRD
AQENILSLRAAAPFNSAAIDRKKWSVTCDSVHEGDDCKNAIDGNGDTMWHTQWEGSEPAP
PHSITVDMKKSYNVNGISMLPRQDGTQNGYIAQHQVFLSKDGKTWGSPVAYGNWYSDWTV
KYANFDTQPARFVKLVALTEANGNPWTSIAELNVFQANDYVPPQASQGAWGPTINFPIIP
VAGTVDPYTGKVIVWSSWARDTMSGGPGGLTLTSTWDPATGQVAERQVTETNHDMFCPGI
SLDGNGQLVVTGGNNAERTSLFDPVQQAWVSGPNMQVARGYQSSATTSTGKVFTIGGSWS
GGSSFKNGEVYDPKKKTWTLLNKADVQRMLTDDAQGLFRSDNHAWLFGWKSGTVFQAGPS
KNMNWYYTDKKNGDVKTAGQRASDRGVAPDAMCGNAIMFDAVKGKILTHGGTPNYQDSDA
TTDAHIITVGNPGTNVTVAYASEGLFFPRVFHSSVVLPNGNVFITGGQEYAIPFEDSTPQ
LQPEMYYPDKDGFELMKPNNIVRTYHSIALLLPDGRVFNGGGGLCGGCDTNHFDAQLYTP
PYLYDAKGKLATRPKIISVSVSSIKVGGTVTVQTGGAIVQASLVRYGTATHTVNTDQRRI
PLTLANAGKNSYSFQVPSDPGVALPGYWMLFVMDKNGVPSVASTIKVTGS

Enzyme Prediction     

EC	1.1.3.9:34	1.1.3.13:3	1.1.3.-:1	1.1.3.7:1	1.1.3.47:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	455	1067	1.1e-240	0.9948979591836735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199882	E_set_GO_C	4.04e-31	968	1067	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
401164	DUF1929	7.89e-28	979	1067	1	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
395611	F5_F8_type_C	8.27e-22	445	572	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
238014	FA58C	2.13e-19	444	576	12	143	Substituted updates: Jan 31, 2002
214572	FA58C	6.56e-08	433	577	1	139	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI59514.1|AA5_2|CBM32	0.0	1	1070	1	1059
QGI90423.1|AA5_2|CBM32	0.0	1	1070	1	1059
CCT63039.1|AA5_2|CBM32	0.0	1	1070	1	1059
QKD46734.1|AA5_2|CBM32	0.0	1	1070	1	1072
CZS75403.1|AA5_2|CBM32	0.0	1	1069	1	1067

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EID_A	0.0	430	1068	1	638	Chain A, Galactose oxidase [Fusarium graminearum]
1T2X_A	0.0	430	1068	1	638	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]
2WQ8_A	0.0	430	1068	23	660	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
1K3I_A	0.0	426	1068	14	655	Crystal Structure of the Precursor of Galactose Oxidase [Fusarium sp.]
2EIC_A	0.0	430	1068	1	638	Chain A, Galactose oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2N3|GAOA_GIBZE	0.0	426	1068	38	679	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1
sp|P0CS93|GAOA_GIBZA	0.0	426	1068	38	679	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1
sp|Q02834|NANH_MICVI	8.01e-18	439	574	504	643	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
sp|Q9FYG4|GLOX1_ARATH	1.18e-16	637	1067	162	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|P29767|NANH_CLOSE	1.32e-13	433	579	45	188	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000283	0.999687	CS pos: 16-17. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in FPRN_01731-t42_1-p1.