CAZyme Information: FPRN_00112-t42_1-p1

Basic Information

• Species: Fusarium proliferatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium proliferatum
• CAZyme ID: FPRN_00112-t42_1-p1
• CAZy Family: AA1
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1547		166171.62	4.5964

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FproliferatumNRRL62905	15602	N/A	348	15254

• Gene Location: location=FCQG01000018:518960-524435(-)

Full Sequence      

MNTGNAPGNIAFSSAVHLASSISWSLHQLSTIPALPLPTNITAVPEYEIVSKLAPALPPI
QVGASFGDVDDMIAGMIAATNVSSPDKSIVGRQSTLRVMVVGDSMSQGREGDFTWRYRIW
QFFKQNSIDVEMVGPYKGTVPPDPPTAPSPPILYGKPVPTSAPKTSGGYAADVDEAFLAN
CNHFSAWGMSYNNIRVVFSQCRAVAVDKGLIQTVLQATPADLILFMLGFNDMGWFYSDAA
GTLDSVDTFVANARAANPNVKIAMADVPQRSFIRGRDDLVKNTEIYNKLLPGYISKWSTK
QSPIHLVQLADNYVGILIQLHTRTDGLHPNAWGEFQIAAAFSKTLVEDFNLGTSPVEIPS
QDDSSLGRPLQGPSNFRVFSSPQGVTATWDPVYGAYSYDVTVSINGGANTYSPTTTSSNR
WDSQWPLEGWTYTVSVRARYGDYSVGPYTSKLSAKATPKLSDPPQNVKVAPAADGFTVTW
DPPTGPNTDSIVEYNILYWDWNPDDCEIITGAAFTSSPAAIKGLTPGRNYLIAPVTWNEN
GQGLPFFANNAVPGAGTPPVPSDLKILSADSTSVHITWTGSDSAGGYHVWNRNVNQKDSK
FEIVSNVTGSTCLDDFLLFPGTWNYEWCISAYNGNEESPQGPAKLAPSPASGVDKDASAP
TCPTAAPWCPAGASVSVPPGQGGTLPPTTGVETITTNGMTLTITTLPASTDGDVTSTMTT
VPPGVSLEDFTDFPVSTNIWITTTGKDSSTTVVPVILPCPSCEPVIVWDTPEIPKVKFKW
PKFPELPTFHLPCIKVFGIKVSGQCPKPEGPAPINDGPPPRPRPSGSPPSDPGDDPCDFD
MKSGMCDNGNYPVYDPGSNTISCDVPSDQLGSKVSQCQSHIDSKLDAVKDYLQGERSCCP
ASSKAKRQESLGLFSSLINRSSGSFGFRLGKRAGDYCPAKNEDPRNPPTGKCYATYTCPD
KLYPNVCGNAKSAINIRGATSILTHQTGSKLHDTSPWYKGRWKATSGRPQGGWKLDKCQV
EEYPFGSGNPDRKASGNSVLRLIPGGGWEDGLENQLQGASLSRWIRTLVKRYNEFQKELT
GTDPKVDGHGFVYCVEFDPGFTNYLPEDLADQNFCASPYGVEFTLVNDYKVRGVRTWDPW
FDVPGTDRKKPELIEYNDPNGDVVVTNPSGDDYAVYAVLPPTYCRYPSPGQQKWDKTTQS
WSLDPRFTSYGRRDDIASFQRCTDPPADADDDDSDSDRLSKRYDNQTQGTMQAEKRTHAR
DLISRQGSSGGFHDPNIYQWLGCGSPDDDIIEDADGDPCADDSNPCGDGATNLATTNGVA
QSLDPLPASGVSTGAITSWPPHYTATDAPSYVPCSTHNADPDGGIARGYCVCSGSTFALS
TDSNATPANRCAYTSPLPKTTVSVSQLPTGPTASAPSPSPYVLVIYTREIEVAGHGGVTD
TWWWDCRPFDKGDQSDSDVCAIKDNPIVYSTAIGRASPSQYPTSLATFSLHGHSSCSYQG
PNTATVGSVVCDDGLTAKCTAAPEASQTSFVDCTDGDEVPNGLARDL

Enzyme Prediction     

No EC number prediction in FPRN_00112-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	96	345	7e-42	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.75e-31	180	345	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238020	FN3	8.26e-09	462	545	2	85	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
214495	FN3	1.30e-07	462	543	2	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
394996	fn3	2.17e-05	462	545	1	84	Fibronectin type III domain.
214495	FN3	2.44e-05	558	638	1	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ09962.1|CE0	1.94e-123	93	651	509	1055
SCG40251.1|CE0	5.35e-98	88	638	328	856
CAK39824.1|CE0	4.18e-83	14	376	59	395
BAE63679.1|CE0	4.76e-83	93	375	54	317
BAE60780.1|CE0	1.60e-78	148	391	19	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5L_A	7.31e-09	165	347	26	201	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]
5B5S_A	7.31e-09	165	347	26	201	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q63870|CO7A1_MOUSE	1.74e-06	325	589	473	718	Collagen alpha-1(VII) chain OS=Mus musculus OX=10090 GN=Col7a1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998811	0.001199

TMHMM  Annotations     

There is no transmembrane helices in FPRN_00112-t42_1-p1.