CAZyme Information: FOZG_18507-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_18507-t36_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846		91896.70	7.5492

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717958.1:999-3853(+)

Full Sequence      

MSPSMDDQLNRQTRYFEMVANGENAVQTPDGPPQYEALAELEATTTARDDGRIDIDLSSR
IARRLSRLVPTEKPPFSYEQRPSSPPEYSETSERSIRLNIVIQVVGSRGDVQPFIALGTE
LQRHGHRVRLATHGQFHKFVQESGLEFFSIGGDPSELMAYMVKNPGLFPSMKTLRGGEIQ
RKRKMVNEMLHKCWKSCIEPDELTGQSFVADAIIANPPSFAHIHCAQALGVPLHLMFTMP
WTSTREFCHPLANLRANGSDMSASAANYVSYSLVEWMTWQGLGDIINTWRNTIDLEPIPF
SEGPCLTETLGVPVTYCWSPALVPKPADWPENIDVCGFFFREVPSYKPNDALHQFLSSGP
PPVYIGFGSIVIDDPEKLTATIMEAVRATGTRAIVSRGWSKLGGDSIGDDQVLFLDDCPH
EWLFQHITAVVHHGGAGTTACGLLNAKPTAIVPFFGDQPFWGNMAHAGGAGPAPIPFKSL
NCQNLADAIRFCLTPEASAAARQIANKMSSEAGVRRAVASFHANLPLEKMRCDVLPNLAA
VWSYEWKGKHVKLSKIAIEILVEAGKISWNNLKPYQSQPVHIENRRWDPVTATLSTLAST
GWGMTKSAADIVVKPIQAFCPVTPGSGRASSRETETHSGTSSKRESEEDIFGRPAGLELP
HPQTNNTKKPQHGVLVAMKASASGISGFFKHSSKGVLLDLPYAITEGMRNAPKLYGGEVY
NPGAVTDWKSGGIAAGKNFAHGIVEGIGGIVMEPVRGAKKEGASGAAKGVGIGLLNLGTK
MSSGAAGLVALPGQGIYQSARALVKRKTGRVIMEARRAEGQYTVGQTDLSQLETYRATVL
DIFETR

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	123	521	3.4e-54	0.9633507853403142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.28e-80	98	523	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.38e-42	100	519	4	392	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.74e-23	100	247	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
227376	MRS6	1.54e-06	649	811	2246	2424	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].
273616	MGT	4.94e-06	358	517	223	382	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57886.1|GT1	0.0	5	846	1	842
QKD56929.1|GT1	0.0	5	846	1	842
QKD46522.1|GT1	0.0	1	845	1	845
QGI59725.1|GT1	0.0	1	845	1	848
QGI76927.1|GT1	0.0	1	845	1	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	8.39e-72	86	525	8	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.40e-71	86	525	28	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	3.95e-28	98	511	1	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	8.17e-28	98	511	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	6.02e-19	98	511	1	386	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	9.92e-130	48	528	111	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	8.73e-127	98	544	193	630	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|P0CN90|ATG26_CRYNJ	2.09e-73	41	537	973	1475	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|P0CN91|ATG26_CRYNB	2.09e-73	41	537	973	1475	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1
sp|Q54IL5|UGT52_DICDI	4.04e-73	98	526	1164	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000003

TMHMM  Annotations     

There is no transmembrane helices in FOZG_18507-t36_1-p1.