CAZyme Information: FOZG_18133-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_18133-t36_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	JH717933.1|CGC1	62422.18	7.7925

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717933.1:55596-57408(-)

Full Sequence      

MMLFYAFAFLGSALASAVPACKLSPSDHNWPSVEEWGELNRTIGYALLKTHPAASSCYRG
NPLDSPLSCRTVEGNWTAAALHAALPESIGSPLYANNSCLPPGADGYNATHGCHLGGYPS
HIVNATSNEQIAIATRWTSQRNIRIVVKGTGHDLFGRSAGAHSLSIWTHNLKNKKLVRKW
KIPGSNKTDTVLIAGSGLNYGEAVGHALNYGRVIVSGNDATVGLGGHIQGGGHGPLSSTF
SLAADNIYQVRVVTTEGQILVADATQNQDLLWAIRGGGAGQYGIVTEYLIKAHAAPRVVN
AGFSVSPAGNSSAAVEASFKAQAALLQDLPSLMDAGWAGAAIVSGNPKTGVTISQGIYAY
NTSPSAVEKLINSTTKHLLTASGGQNSSLITIMPDEISESSYLSFFNNVNAGGSHTAGAM
SMVSSRLLGRPELSDLSQEKLVGYAKRLLSKGFAVIGLQGGPGPAKVDKSMRGALLPTWR
SNYLHVMSYGAKFNTALAPQDMLNDTAEQLEEGTESLWREWAPETGAYMNEGNPFNSNFK
KDFYGSYYDRLLEVKNKYDPTNSLWVLSGVGSDAWDYNLNTGRLCKQ

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	115	327	6.5e-42	0.4344978165938865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
369658	BBE	8.62e-09	527	562	1	36	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
223354	GlcD	1.55e-06	117	564	30	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	4.56e-06	119	263	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
215242	PLN02441	1.57e-04	246	304	193	256	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	0.0	11	587	490	1066
QKD57322.1|CBM91|GH43_11	0.0	11	587	490	1066
UQC87672.1|AA7	3.67e-17	119	572	70	497
BAI44126.1|AA7|CBM18	6.39e-17	95	299	248	447
QBZ61916.1|AA7|CBM18	6.39e-17	95	299	248	447

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	2.08e-81	19	586	26	573	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	7.53e-57	15	587	24	598	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6EO5_A	6.53e-19	119	293	48	216	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	6.53e-19	119	293	48	216	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6FYE_A	1.39e-16	119	293	45	209	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QDQ9|VAO15_MYCTT	1.07e-80	19	586	26	573	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1
sp|S0DL65|APF9_GIBF5	1.05e-71	12	586	11	584	FAD-linked oxidoreductase apf9 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) OX=1279085 GN=apf9 PE=1 SV=1
sp|A0A0E0RTV6|ZEB1_GIBZE	6.92e-71	10	586	16	562	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A1CFM2|PATO_ASPCL	2.47e-65	21	586	29	567	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|A0A075TR33|PATO_PENEN	2.45e-64	21	586	28	566	FAD-linked oxidoreductase patO OS=Penicillium expansum OX=27334 GN=patO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000548	0.999420	CS pos: 17-18. Pr: 0.8966

TMHMM  Annotations     

There is no transmembrane helices in FOZG_18133-t36_1-p1.