CAZyme Information: FOZG_18079-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_18079-t36_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	JH717930.1|CGC1	46892.22	4.4394

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717930.1:80587-81949(-)

Full Sequence      

MRTKVASACGTEEMVPGMSYVHMVDKLWGSWNQTCFTDPKTGEFCHDVIAAFPEVDDVSK
LSKSDLCSYCNVEQYKIMQADAYSGAYDEYAQSNYKYVAKACDLKVDNFNPTDSAFNVTN
PDASSEVCVSGKIYGAKAGDSCDSIALSQGVSAATMYYINSNIFDCTKIAVGTSLCLPLT
CTKIYRVQKGDTCLDIALNNGIMSDQLLSYNSQLNWNCTNLHDADPYWGSTLCVSTPGGI
YAGQPLNNNTANTDPQRIDPPAGATVANGTTLECSHWLTYDGGLSCTQICLANDVAINLF
TEINPSLNKTTCDEDLKAGNAYCVKPITGWDLPAFTKTATGQATATKSASPSGTKSTAAT
ASAPQTSTSEKVPSPTQPGIVDSCNQWHYVDNGDGCYSIAETYHINLADFYKWNSKVGND
CSGLWLHYYVCVGVAS

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	1.37e-08	386	430	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	2.60e-06	183	221	1	39	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
237555	PRK13914	3.84e-05	333	415	147	229	invasion associated endopeptidase.
396179	LysM	4.57e-05	185	234	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
197609	LysM	1.61e-04	137	177	5	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59081.1|CBM50	3.48e-284	1	429	90	488
QKD61253.1|CBM50	3.48e-284	1	429	90	488
CZS74850.1|CBM50	9.15e-274	1	436	90	525
CEF83616.1|CBM50	3.92e-268	1	436	90	525
APA07678.1|CBM50	2.50e-156	1	434	109	527

PDB Hits     

FOZG_18079-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	4.89e-23	181	434	155	373	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AVW3|LYSM5_ARTBC	9.81e-18	181	436	262	538	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4B5F9|PGDA_ARTBC	3.08e-14	376	434	379	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4B4P8|LYSM2_ARTBC	6.08e-10	274	434	29	181	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	8.39e-09	373	434	347	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000063

TMHMM  Annotations     

There is no transmembrane helices in FOZG_18079-t36_1-p1.