CAZyme Information: FOZG_18027-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_18027-t36_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548		60521.82	6.3062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=KI981473.1:68002-69705(-)

Full Sequence      

MPLALKRNQANYDTAADALLSILTFKERLWILDGDQEFWPGLHALTTEGFCHTFYTMGEV
PRLKIPGVRLSDGPRGYEALEERVGRAIGRECKALGANQFGGICINLPRHPSWGRIQETY
GEDPIILGKMATAVTKGVQENVMGCLKHLALNSMENARFKVDVQVDDDVLHEVYLPHFRH
VVEQGIASVMSAYNSVRGQFAGQSRELLMDILRDRWGFKGFVVEDFLFGFRDVALSLKNG
LDLEAPFRQQRAQHLEAALINGDVSQSDVDRAGRAILRSLIENEVLRGDSKPTKDIIFYG
EHRSLARESATRSMVLLKNDAVNGRPLLPLGSDLSRVAVVGWQADSKNTGGKGSSHVRCP
EVISPFQGIKEALPHAEVVVESSNDISKVKRAAASADAVVMVVGYDFHDEGEYTAPAFNA
TPALRHVIPPDDDSKEARSVIERLMNPAPKKGERGKDNYGFGTGGTVIVEEWKDLPSAII
FGWYSGCEGGCALADLLLGKVNFSGRIPFCIPTCEEHLPKADNDAEAIKYDRWYGHCSIG
FKFQLHFP

Enzyme Prediction     

No EC number prediction in FOZG_18027-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	80	245	3.5e-46	0.7916666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.04e-46	59	384	54	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	4.10e-41	82	519	136	614	beta-glucosidase BglX.
178629	PLN03080	8.65e-37	16	508	53	585	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.80e-32	314	531	1	209	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	5.72e-30	82	278	104	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60166.1|GH3	6.01e-312	130	548	1	419
UPK96878.1|GH3	7.30e-239	4	535	22	601
AGC95327.1|GH3	2.97e-189	19	535	29	592
QGI96189.1|GH3	1.86e-187	4	535	29	612
QGI65307.1|GH3	1.86e-187	4	535	29	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X40_A	7.33e-48	19	519	7	555	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	1.83e-47	54	519	26	508	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X42_A	8.90e-47	19	519	7	555	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	3.72e-40	80	540	85	521	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	6.13e-38	42	373	19	375	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14002|BGLB_ACET2	9.42e-47	54	519	26	508	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|A7LXS8|BGH3A_BACO1	2.68e-41	42	519	50	581	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|F6C6C1|APY_BIFBA	1.75e-40	80	512	85	508	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
sp|Q5BA18|BGLK_EMENI	3.29e-40	52	382	32	385	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|E7CY69|APY_BIFLN	4.35e-40	80	540	85	530	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOZG_18027-t36_1-p1.