CAZyme Information: FOZG_17883-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_17883-t36_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		59825.44	7.1753

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717925.1:43821-45508(-)

Full Sequence      

MAAPVEDLLDQTTYDYVVVGGGTAGCVIASRLAEELPSAKILLVEGGGSDVGNDMLHDLK
RLVETWGGDFDWDWSSVPQPNGNSLIRHSRGKVLGGCSNINGCISFRPMEYDIRKWKEAG
VEGWTFDEFVRLINKVRITVNKINQRNHNSVDLALVESAKKAFHIPWSPEFNKDIVQRGN
ITPSAGHLSIAHNPENGFRSSASIEYLHPIIRGEVKRPNLTILTNAWVHRLHFVDKVATG
ASITLKSGRDVVVRSKIETILCAGSFDSPRLLLVSGIGPREQLEKFKVPVVADVPGVGEN
LMDHAETAMMWEMKDQVPPETIIHSDVCFFLRREPPNSQGDDGDIMDSMFHVFGIGFDDN
TARHGYNAPPNAYCLIPNLPRPKSRGRLYLQSSDLKVRPAVDFRYFTDTGDYDLKTIVFE
LKAGRRFAATAPFKELIKREIAPGPQVQSEEQLIDYARKTHGTVFHPCGTVKMGNTAQDP
MAVVDSQLRVRGVKNLRVIDASVFPVIPSINLMLTVYAVAEKGAEMIIKDYASAGVRPKI

Enzyme Prediction     

No EC number prediction in FOZG_17883-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	532	4.9e-92	0.5145631067961165

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.66e-108	13	530	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.15e-107	11	527	3	531	choline dehydrogenase; Validated
274888	Rv0697	3.33e-60	15	527	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	8.00e-43	382	522	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.94e-28	12	536	54	587	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56849.1|AA3_2	0.0	1	540	1	540
UPK89107.1|AA3_2	2.83e-315	10	540	10	540
QMW36122.1|AA3_2	1.52e-208	10	540	11	542
QRD92907.1|AA3_2	1.52e-208	10	540	11	542
QMW48182.1|AA3_2	1.52e-208	10	540	11	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.82e-104	5	527	6	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.82e-104	5	527	6	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	7.19e-104	5	527	6	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
4YNT_A	2.85e-50	9	534	1	571	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4UDP_A	3.56e-48	9	528	1	528	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	9.38e-104	5	527	6	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	1.02e-66	14	540	2	540	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q1QXE1|BETA1_CHRSD	2.50e-64	14	527	7	535	Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA1 PE=3 SV=1
sp|Q4A0Q1|BETA_STAS1	3.48e-64	11	527	2	533	Oxygen-dependent choline dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=betA PE=3 SV=1
sp|Q00593|ALKJ_PSEOL	6.49e-64	14	530	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOZG_17883-t36_1-p1.