CAZyme Information: FOZG_17697-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_17697-t36_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		51358.36	6.1095

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717921.1:52971-54383(+)

Full Sequence      

MDYSHTSIASSLRCQVIVPRRNQAPSETVSRWSDHNVEFPAMIVRPNSEQDIADSIKLAR
NNELILLPGNGGCASWVPITAKTMYLDMKNFNNVIVDQSSSTVRVGGGASTGEVIKAVVA
AGYYTLWCNSNAVGYVGSILGGGISPFTGLHGYLIDAVESIQLITTDGQILDVGPSSEGE
EKALFNALCGAGHGLGIITSVVMKVFSLKILNMTEDCFWTRRVVFPSSAIEAAAKAFTQF
SDPDPHLVINMVFFRALPSTSALGSPMITLTASYFGPSNEAEQAATVLFDQSIIGKAVEA
ETLLVSVATANDRNNHMNIHGGFKDTWSCFVSSVDGAAIKESFERWVQVAERDQGAKRTL
VLWGRFNTNMAVSLGQSPEGQGKFLGVRDRGVFTNVVKYADTLESNRALDQFCYDHLDIA
RRRDAGLPRMLANNRRPGINLQELYPKEKVAELMRVKQVWDSEQLLWSPF

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	31	463	2.7e-34	0.9672489082969432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	9.77e-19	40	470	32	454	FAD/FMN-containing dehydrogenase [Energy production and conversion].
215258	PLN02465	3.81e-06	26	205	83	260	L-galactono-1,4-lactone dehydrogenase
223882	MurB	1.51e-05	42	204	23	179	UDP-N-acetylenolpyruvoylglucosamine reductase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK90596.1|AA7	1.62e-11	40	204	20	185
ATZ50592.1|AA7	1.02e-09	9	253	32	283
QRD00400.1|AA7	1.25e-09	40	280	46	279
UNI23960.1|AA7	3.80e-09	40	282	48	281
QRC92907.1|AA7	1.22e-08	40	218	63	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BVF_A	1.06e-16	32	242	31	239	Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVF_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVG_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVH_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans]
6FYD_A	1.71e-10	32	200	37	203	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
3POP_A	1.46e-06	40	327	35	322	The crystal structure of GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3POP_B The crystal structure of GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3POP_C The crystal structure of GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3POP_D The crystal structure of GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3PQB_A The crystal structure of pregilvocarcin in complex with GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3PQB_B The crystal structure of pregilvocarcin in complex with GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3PQB_C The crystal structure of pregilvocarcin in complex with GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3PQB_D The crystal structure of pregilvocarcin in complex with GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus]
3HSU_A	3.38e-06	40	222	43	227	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
1ZR6_A	4.47e-06	40	222	43	227	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G3XMD0|AZAL_ASPNA	2.24e-26	6	280	24	293	FAD-linked oxidoreductase azaL OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) OX=380704 GN=azaL PE=2 SV=2
sp|Q5BEJ5|AFOF_EMENI	1.49e-22	27	206	45	225	FAD-linked oxidoreductase afoF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afoF PE=1 SV=1
sp|G4N285|OXR1_MAGO7	1.75e-22	31	374	69	403	FAD-linked oxidoreductase OXR1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=OXR1 PE=1 SV=1
sp|G3XMC1|AZAG_ASPNA	8.15e-22	28	281	49	293	FAD-linked oxidoreductase azaG OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) OX=380704 GN=azaG PE=2 SV=1
sp|Q0CF74|AZPB3_ASPTN	3.89e-21	31	277	56	293	FAD-linked oxidoreductase ATEG_07660 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_07660 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOZG_17697-t36_1-p1.