CAZyme Information: FOZG_17640-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_17640-t36_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
868		94953.35	5.2234

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717920.1:33969-36705(+)

Full Sequence      

MESFNLPYGELLQHLTTSEKISLLSGSDFWHTQSIPRLSVPKLRMSDGPNGVRGTKFFNS
VPAACLPCGTGLAATWSHDMMREAGDLIARECHAKSAHVWLGPTTNIQRSPLGGRGFESF
SEDPLLGGSLASALISNVQKNDIACSLKHFVANDMEHERTLVDCRISPRALREIYLLPFQ
IAIRDADPWALMTAYNKVNGQHMSEHQDILQEILRNEWGYRGCIMSDWFGTYSTAAAINN
GLDLEMPGPTEQRGKRVATALGVGKIRSSTIDARVASVLRLADRVRESGIPECGPESCLD
TDQDRSVLRRLATESVVLLKNDDHVLPFRADKKASQPDSFHCLLTPVTNFEEQTVVIGPN
AQKSFFCGGGSASLRPTRVVSILEGLRDKLEQPVEYTEACQIYNQLPVLGDIIRAPDGTL
GQFLMSIYTSPPTMQQLNNNEITDTREAIEVLQLDDSNVVLYDYSNPAAPDNVVYATIAA
DLVVDNTDTYAFSLTVAGTATLYLDNDLIVDNSHDQKRGTSFFGSGSAEKIKHVQLVANR
VYKLRCEFGSAATSNLNKAGAPVFGAGGVRIGCARCSNESLELDRAVELAKEADQVVVCV
GLGPEWESEGSDRALYELPGRQSELLSRVTAVNKNVVVIVQSGTPVSGPWDQVAAVMQTW
YGGNELGHGIADIVLGRESPSGKLPLSWPCSIEDNPSFLSYRSEAGTCYYNEDIFVGYRF
YEKARRKVQWPFGFGLSYASFILEQPSVQIRGSGVDANMLVTVPVYNNSAATSGKEVIQV
YVSCITPSAVRRPVKELKGFTKLFVPAGETRQATIEIPIKTAVSVWDVTTDSWLMEKGTY
KLSVGNSSDSALLSTQFQVPVTQHWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	247	4.3e-64	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.60e-60	28	396	48	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	8.55e-56	67	851	121	755	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	6.36e-47	565	718	63	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.81e-36	66	281	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.66e-34	11	817	56	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57157.1|GH3	0.0	1	868	1	868
QKD63131.1|GH3	0.0	1	868	4	849
CCT75990.1|GH3	0.0	1	868	4	875
QGJ02135.1|GH3	0.0	1	868	4	875
QGI71242.1|GH3	0.0	1	868	4	875

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.04e-237	10	868	8	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.65e-233	10	868	8	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.29e-117	10	862	7	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.21e-116	15	848	12	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.02e-78	10	859	6	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	7.06e-260	12	868	10	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	1.69e-259	10	868	16	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.14e-258	6	868	4	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	1.98e-258	10	868	16	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q4WLY1|BGLJ_ASPFU	2.81e-258	10	868	16	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000013

TMHMM  Annotations     

There is no transmembrane helices in FOZG_17640-t36_1-p1.