CAZyme Information: FOZG_17583-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_17583-t36_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	JH717919.1|CGC3	52179.74	6.4099

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717919.1:80098-81555(-)

Full Sequence      

MGPFACGLTALNLLGCISPAFVAAVPMDLYSGSEVLISVNGLVKHQELDGFGASQAFQRA
EDILGKDGLSKEGTQRVLDLLFSKDIGAGFSILRNGIGSSNSSEKNFMNSIEPFSPGTPG
AKPHYVWDGYDSGQLTVAREAFKRGLKFLYGNAWSAPGYMKTNQDENDGGYLCGVTGATC
ASGDWKQAYADYLLQWVDFYRKSGVKVTNLGFLNEPQFAAPYAGMLSNGTQAADFIRVLG
KTIQKRGIHDLTITCCDGEGWDLQEDMMAGLTAGPDPAINYLGVVSGHGYVSPPNHSLST
TKKTWLTEWADLTGQFTPYTFYNNSSQGEGMTWAGRIQTALVDANVSGFLYWIGAENSTT
NSALINMIGDKVIPSKRFWAFASFSRFARPGARRIEATSSVPLITVSAFLNTDGTVATQV
LNNDTVAHHVRLVVSGTGRSPHSLKPFLTDNSNDLTALEHLKAAGKGSFQTTIPPRSLVS
FITDS

Enzyme Prediction     

EC	3.2.1.8:3	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	36	481	1.3e-183	0.9887133182844243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	2.05e-24	20	484	14	429	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
396577	Glyco_hydro_59	1.46e-11	76	355	26	256	Glycosyl hydrolase family 59.
405300	Glyco_hydr_30_2	4.86e-09	34	353	1	354	O-Glycosyl hydrolase family 30.
407314	Glyco_hydro_30C	1.37e-06	391	446	1	57	Glycosyl hydrolase family 30 beta sandwich domain.
307945	Glyco_hydro_30	1.76e-06	48	243	1	190	Glycosyl hydrolase family 30 TIM-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62253.1|GH30_7	0.0	1	485	1	485
CCT73045.1|GH30_7	0.0	1	485	1	485
QGI99540.1|GH30_7	0.0	1	485	1	485
QGI68650.1|GH30_7	0.0	1	485	1	485
QGI85842.1|GH30_7	0.0	1	485	1	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IUJ_A	2.20e-190	34	484	21	472	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	1.28e-189	34	484	92	543	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
7O0E_A	2.14e-123	37	482	5	446	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	4.42e-122	37	482	12	453	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	1.39e-98	37	482	25	452	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	3.04e-123	16	482	10	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|Q6YK37|XYNC_BACIU	8.37e-10	134	482	98	420	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
sp|O16580|GLCM1_CAEEL	7.48e-09	149	434	193	493	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2
sp|Q45070|XYNC_BACSU	3.31e-08	134	484	97	421	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
sp|O16581|GLCM2_CAEEL	3.49e-06	140	427	185	484	Putative glucosylceramidase 2 OS=Caenorhabditis elegans OX=6239 GN=gba-2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004632	0.995340	CS pos: 15-16. Pr: 0.3148

TMHMM  Annotations     

There is no transmembrane helices in FOZG_17583-t36_1-p1.