CAZyme Information: FOZG_17435-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_17435-t36_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
563		62901.06	5.1791

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717918.1:85303-86994(+)

Full Sequence      

MARLAIPHLQPTANSAQLIVKGQPFLMLPAELQNSSLSSADYMSSVWSDLKAANFNTVLG
SVSWDAIEPEEGKFDFSELDKIILDARQHGLHLVLLWFGSYKNATSSYVPNWVKSNPIRF
TRVQILDNDRRLKATGTISPFCRAAWEADAKAFSTLMRHIKEIDAAHSTVLTTQVENECG
VLGDSRDRSELADKAFQQPVPLELLAHLAGKQQLHPEFEKRWPRFRETVDLEHSKTWEQS
FGPGNTADEMFMVHALAAYVGKVAQAGKDEYPIPFFANVWLNTDDESILDVDGVPEDLRL
GIVAAGGSKPGEYPSGSPCPHTLDLWKYCAPALDFISPDVYLQDYEWVCKQYRYENQPLL
IPEQRADGRGSRQAWLAYGSYGALGCSPFGIDTVAAVENEFKKPYGLLAKMSHHILTAQA
SHPEDMFGFFFDEPSLTARDSWIRSMGNFSLRVERSFTFGKKTPGYGIIIHRGQGRFLLI
GEGFQVRFESLNPDTTYAGILEFRELNASPEGQLSEGRRLNGDERMNGDVAMMPSETPDY
GGYPIRVTVPSRTCIAECLAYSI

Enzyme Prediction     

No EC number prediction in FOZG_17435-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	18	211	6.6e-31	0.5830618892508144

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407954	DUF5597	1.03e-28	401	528	1	126	Domain of unknown function (DUF5597). This is the C-terminal domain of xyloglucan utilization locus (XyGUL) present in Cellvibrio japonicas. XyGUL is required for xyloglucan utilization. It is also the C-terminal domain of PF02449 and PF01301.
396834	Glyco_hydro_42	1.18e-09	51	198	20	156	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
396048	Glyco_hydro_35	1.99e-09	17	251	1	214	Glycosyl hydrolases family 35.
224786	GanA	4.33e-09	17	342	7	367	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
214750	Glyco_10	1.20e-07	64	117	3	51	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57817.1|GH35	0.0	1	563	1	563
UPK89137.1|GH35	8.54e-279	1	563	1	561
UPL04311.1|GH35	3.07e-207	2	561	11	555
QRC90616.1|GH35	6.16e-206	1	563	1	563
CEI70370.1|GH35	7.89e-204	7	563	10	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMN_A	1.79e-64	1	392	21	364	Chain A, Beta-galactosidase, GH35 family [Xanthomonas citri pv. citri str. 306],7KMO_A Chain A, Beta-galactosidase, GH35 [Xanthomonas citri pv. citri str. 306]
3U7V_A	1.03e-59	2	494	35	502	The structure of a putative Beta-galactosidase from Caulobacter crescentus CB15. [Caulobacter vibrioides NA1000]
4D1I_A	7.76e-54	6	392	4	342	The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_B The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_C The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_D The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_E The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_F The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_G The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_H The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1J_A The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_B The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_C The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_D The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_E The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_F The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_G The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_H The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107]
5JAW_A	9.34e-54	6	392	14	352	Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_B Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_C Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_D Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_E Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_F Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_G Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_H Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],6TBF_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBI_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBJ_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RSQ1|GLBL3_MOUSE	1.66e-06	47	205	80	230	Beta-galactosidase-1-like protein 3 OS=Mus musculus OX=10090 GN=Glb1l3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOZG_17435-t36_1-p1.