CAZyme Information: FOZG_17262-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_17262-t36_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1171	JH717915.1|CGC1	131350.87	9.1931

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717915.1:296366-300114(-)

Full Sequence      

MRLIFVLVVLLRSSFATVPSSHRRFFTPEGFIKVDPGGPEDIEVTPDNLLSERLSKNTNP
VLTGRGLDSRALSIRLVNNFDNSSVKAYITGLDSGGKVFFALHDGKLIYPDARGSRLPVK
VTEEVAISLPAKGESLRITLPSFIRSGRIYISNDDLQFFVVDRDNGNSLVQPSVTNLRDP
NANVSWGFVEFTYIRNLLYANISYVDFVGLVLGMMLVAKDGSTQTTAGLEADAVNKICDD
LIKQRKLDNHKWTSLCIADTAGKPIRVLSPGNQHDVDPEIFGSYWKTYVDRVWERYIARD
LIIDTQSKAGMVKCRIVDHKLKCDGHERGLPKPDDKDIWGCNSGPFAISENDSIIHTAIV
PRLCAGLVRSTLLLDGGFMQPSLGQTSHYTVNPTNHYSRIVHSYEVDGRGYAFSYDDVNP
DNGEEASGVLDLRYSPPRKSPTQILQVSPRAESPESLFFQQISSPFPGPIPNPPSPGDPA
PSAEALFDLVNLFAKENGFGIVRRNAYSYKGRRIRYSLQCDRFGQPGASKGAGLRQRKSR
KCGCKWMVIAEALEEGKWLLRQHPNLEHSQHNHGPSITSSAHPSHRRLTTPVRATIELTS
RRVGIRARDGRAVVEEQHPESSFTQRDIYNARALINREKLNSYTPTAALIKLFDEMEIPY
LAKWADDQPNRLLGLVWTFPYCIQMWKRFPEVISFDNTYNTNRFKLPLFQATGQTCLGTV
FNAAFGLIDNERREGFQFLAESIRPLIGQHSIRQPDVIITDFDDSMKAALNDQFPDVQQQ
LCIYHINSNVLLKSKQKWAKKRKSSSSPDASDWEDSAPQTQAELRLTDKQLVHALTGDEI
PHTYRGVLMMWKRVLFAETEEAHEKAWRDLCKKFDDQRAILRYLHGTYLPSYLLNGMSHL
YRLVEAMQDMMKDQERDFKDACAQDEVLTARKYLGSSGDYLGDLPTVISSKALGLTNKQY
RIARKAMPTGKSPFPEPLSDCNDDCSVSVELGVPCCHKVYAKLGSATSFTRYDVHPHWRL
RDSSSQDPYRRILDPRIATALRGRPKNTAQPVPSRMAVGGSSQNVSQLASLAARQPAGRK
RGRPPRIVNKSTLTRVSLEASQHNNTQANSNVSSIPTQCQTRSHSDTLGSGRTTGVRASG
RRTQPSIRRTRSQWELVDSDENILPSIVVRE

Enzyme Prediction     

No EC number prediction in FOZG_17262-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH64	71	422	3.1e-84	0.9482288828337875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185759	GH64-GluB-like	1.48e-157	72	428	1	354	glycoside hydrolase family 64: beta-1,3-glucanase B (GluB)-like. This subfamily is represented by GluB, beta-1,3-glucanase B , from Lysobacter enzymogenes Strain N4-7 and related bacterial and ascomycete proteins. GluB is a member of the glycoside hydrolase family 64 (GH64) involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. GluB possesses the conserved Glu and Asp residues required to cleave substrate beta-1,3-glucans. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Based on the structure of laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis, which belongs to the same family as GluB but to a different subfamily, this cd is a two-domain model. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain.
406796	Glyco_hydro_64	1.67e-144	71	430	2	358	Beta-1,3-glucanase. Family 64 glycoside hydrolases have beta-1,3-glucanase activity.
185755	GH64-LPHase-like	1.33e-66	72	418	1	333	glycoside hydrolase family 64: laminaripentaose-producing, beta-1,3-glucanase (LPHase)-like. This subfamily is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain.
402263	MULE	2.13e-40	692	789	1	98	MULE transposase domain. This domain was identified by Babu and colleagues.
185753	GH64-like	4.30e-32	76	419	5	300	glycosyl hydrolase 64 family. This family is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain, and in the Salinispora tropica CNB-440, coagulation factor 5/8 C-terminal domain (FA58C) protein, they are positioned C-terminal of two FA58C domains which are proposed to function as cell surface-attached, carbohydrate-binding domain. This FA58C-containing protein has an internal peptide deletion (of approx. 44 residues) in the LPHase domain II.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57567.1|GH64	0.0	1	1171	1	1191
QKD57507.1|GH64	5.49e-269	18	430	10	422
UPL03538.1|GH64	2.08e-172	1	430	1	434
QGI96057.1|GH64	1.49e-170	1	430	1	429
QGI65175.1|GH64	1.49e-170	1	430	1	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GD0_A	3.75e-25	118	418	53	344	Chain A, Laminaripentaose-producing beta-1,3-guluase (LPHase) [Streptomyces matensis],3GD9_A Chain A, Laminaripentaose-producing beta-1,3-guluase (LPHase) [Streptomyces matensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2HEW5|CHEA_CHAGB	4.98e-92	484	1058	64	659	PKS-NRPS hybrid synthetase cheA OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=cheA PE=2 SV=1
sp|P22222|E13B_CELCE	9.32e-19	134	418	101	375	Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans OX=1710 PE=1 SV=1
sp|Q59146|E13B_ARTSW	2.87e-18	134	418	101	375	Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) OX=79671 GN=glcI PE=3 SV=1
sp|Q9SZL8|FRS5_ARATH	2.05e-10	482	786	81	390	Protein FAR1-RELATED SEQUENCE 5 OS=Arabidopsis thaliana OX=3702 GN=FRS5 PE=1 SV=1
sp|Q9SY66|FRS11_ARATH	2.19e-09	484	786	58	368	Protein FAR1-RELATED SEQUENCE 11 OS=Arabidopsis thaliana OX=3702 GN=FRS11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999735	CS pos: 16-17. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in FOZG_17262-t36_1-p1.