CAZyme Information: FOZG_17116-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_17116-t36_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866		93562.87	5.0533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717914.1:170634-173612(+)

Full Sequence      

MRLLSCFSRSRLPRSYPRPSPIVDWGFVIMVSHRSLWLLALAPLTQYVSAQQSTPAPYTD
PGTGIVFDTWTASRMTFGFSFPENGQTTNADEFIGYLNCATPNGEGTGWCGLSYGGPMTN
SLLLFAYPHDGDILTAFLWANAQVEPVPYEGEAVLTQISSSITEDGFTLIYRCQGCTSWS
QDGNSGQLATTSPVAVLGWAHSTTNVINPECPREARMVQHETQSIFGGQLTSNAFNNEYD
KWAKLATKVVEGNCDGGGEEPTSTATGEPTSTAAPPTGTPVPDETYDYVVVGGGAGGLPV
ADRLSEAGKKVLLIEKGPPSSGRWGGTRKPDWLEGTNLTRFDVPGLCNEIWADSSGIACP
DTDQMAGCVLGGGTAINAGLWWRPNPKDWDFNFPDGWKAKDMAKYEGRVFGRIPGTRVPS
MDGKLYLDQGFKVVAGALDQAGWDEVNALEKPAAKNRTYTHPPFMFSGGERGGPLATYLV
SAKARNNFKYWTNTQVRRVVRSGGHVTGLEVEPFAGAGYVGTVKLTPETGRVILAAGTFG
SAKILLRSGIGPDDQLKIVANSSRDGGSMIAKDQWINLPVGYNLEDHTNTDTVIKHPDVV
FYDFYKAYDDPIPADEKKYLDERSGILAQAAPNIGPVIFDEISGADGRVRSMQWTARVEP
SLGETSNKSITISQYLGRGAKSRGRMTITSALNTVVSGNPYLNDPEDKKAVVTALDNLRE
ALSGVKGLEWLQPAPDVTSQQYVDDMVVSWSNRRANHWIGTNKLGKDDGRQGGTAVVDLN
TKVYGTDNLFITDASIFPGMVTTNPSAYIVTAAERASDAIIALPVSKAQGQYQQCGGIEW
TGNMQCGKGFYCKSLNPYYSQCYPDA

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	273	823	4.9e-252	0.9908759124087592
AA8	58	242	8e-59	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	3.12e-59	58	232	1	172	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225186	BetA	8.75e-43	282	820	4	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
187688	CDH_like_cytochrome	1.77e-36	57	230	1	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
235000	PRK02106	4.24e-27	301	820	21	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.30e-24	681	816	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55357.1|AA3_1|AA8|CBM1	0.0	30	866	1	837
CCT69443.1|AA3_1|AA8|CBM1	0.0	30	866	1	854
QGI82521.1|AA3_1|AA8|CBM1	0.0	30	866	1	854
QGI96154.1|AA3_1|AA8|CBM1	0.0	30	866	1	854
QGI65272.1|AA3_1|AA8|CBM1	0.0	30	866	1	854

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI6_A	0.0	53	862	3	806	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI7_A	0.0	53	862	2	805	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	1.75e-277	280	862	1	584	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	6.59e-123	286	823	3	537	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	7.68e-123	286	823	8	542	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	7.89e-153	38	823	6	769	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q47944|SDH_GLUOY	1.94e-24	286	820	5	527	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|B9JBA2|BETA_AGRRK	6.77e-23	287	824	4	529	Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=betA PE=3 SV=1
sp|E4QP00|HMFO_METS6	3.34e-22	283	821	3	528	5-(hydroxymethyl)furfural oxidase OS=Methylovorus sp. (strain MP688) OX=887061 GN=MPQ_0130 PE=1 SV=1
sp|B3PTE0|BETA_RHIE6	2.72e-21	287	821	4	526	Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CIAT 652) OX=491916 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.551014	0.448982

TMHMM  Annotations     

There is no transmembrane helices in FOZG_17116-t36_1-p1.