CAZyme Information: FOZG_16735-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_16735-t36_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		35152.53	6.0326

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717911.1:573254-574301(+)

Full Sequence      

MPTNGVQYLINCRDPTSKVVLPDVTLVRTGMDALPNPDADTNAPPHEQEPNSTWQLFNYG
FGPYNDGIFTQSPLGIVVKMGIWLMVNPGGYQSYLITIPKDEDLHQAIEIIRPLRTSMVL
QNVPTVRHVLLDAAVMGSRDKFTTSKKPLNDKELDEISEKLNLGRWNFYGALCGPEPIRK
VMWKVVKDAFSAIPGTKFDFLEDMPDNVVLQTRDLTLQGIPTMTELEWVNWLPNGAHLFF
SPIAKVTGDDAVAQYALTRKRCEEAGFDFIGTFVVGMREMHLNTTIKNALDPKGICRPVR
MGYGQAAITQRTLL

Enzyme Prediction     

EC	1.1.3.38:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	18	282	1.4e-109	0.4789272030651341

CDD Domains     

FOZG_16735-t36_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61133.1|AA4	1.28e-203	31	298	1	268
QGI94813.1|AA4	6.06e-182	5	302	188	542
QGI63931.1|AA4	6.06e-182	5	302	188	542
AFJ11909.1|AA4	4.93e-181	5	302	188	542
QGI81201.1|AA4	4.93e-181	5	302	188	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1E8F_A	3.04e-126	18	281	201	466	Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8F_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8G_A STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8G_B STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8H_A Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum],1E8H_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum]
1DZN_A	3.04e-126	18	281	201	466	Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1DZN_B Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1W1K_A	6.08e-126	18	281	201	466	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum],1W1K_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum]
1E0Y_A	2.44e-125	18	281	201	466	Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1E0Y_B Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
5MXJ_A	4.88e-125	18	281	201	466	Structure of the Y108F mutant of vanillyl alcohol oxidase [Penicillium simplicissimum],5MXJ_B Structure of the Y108F mutant of vanillyl alcohol oxidase [Penicillium simplicissimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56216|VAOX_PENSI	2.51e-124	18	281	201	466	Vanillyl-alcohol oxidase OS=Penicillium simplicissimum OX=69488 GN=VAOA PE=1 SV=1
sp|P09788|DH4C_PSEPU	2.77e-41	5	281	176	436	4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida OX=303 GN=pchF PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000014

TMHMM  Annotations     

There is no transmembrane helices in FOZG_16735-t36_1-p1.