CAZyme Information: FOZG_16722-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_16722-t36_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539		60208.93	6.6771

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717911.1:550313-552009(-)

Full Sequence      

MTVVEKLDETSYDYVVVGGGTAGCVIASRLAEKLPYTEILLIEGGANDFKNETILNLKCL
LDLWGAEDYDYGYSSVPQPFGNSNIIHSRAKMLGGCSSHNGGISFVPFDMDMKKWQKMGA
NGWTHAEMVRLFKKLRNNIIPIAEDQRSQITKDWIESCSKLFNVPKVEDFNKQIIRDGRL
TPGTGYVSCTYTPDNNHRSSASVAYIHPILRGDEFRPNLTILHKTWTSKIHVKDQTAVGV
RATTDAGTTYDIYARKEVILCAGAVDTPRLMMLSGLGNRQQLEKLGIEVHQDLPGVGENL
QDHVESMYMWEIKDEVPQDKIVMGSEACMVLRREPENAQGDDGDAIDTMFHMFTVPFDFY
TKTMGYETPKNAFCCIPYNPRPASVGRLYLTSADPKVKPALDQRYFSDEKGYDKASNLWM
LKQARKMAQSEPFRKHLLREIAPGPMITTDDQLCEYGRQVSNTVYHPCGTAKMGDTRRDA
MAVVDASLHVKGIKNLRVADASVFPCMVSINPMITVLCIGERAAELIIADSKTAPRPSL

Enzyme Prediction     

No EC number prediction in FOZG_16722-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	529	4.7e-128	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.88e-108	11	536	7	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.66e-101	9	527	3	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.63e-37	382	523	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	9.08e-25	9	520	53	569	Protein HOTHEAD
366272	GMC_oxred_N	4.70e-24	69	305	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61121.1|AA3_2	0.0	1	539	1	539
QMW36122.1|AA3_2	1.55e-215	8	531	11	533
QRD92907.1|AA3_2	1.55e-215	8	531	11	533
QMW48182.1|AA3_2	1.55e-215	8	531	11	533
BAE65509.1|AA3_2	1.55e-215	8	531	11	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	2.07e-95	4	527	6	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	2.07e-95	4	527	6	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	8.10e-95	4	527	6	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
4YNT_A	6.34e-57	7	534	1	571	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	7.37e-42	12	530	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.06e-94	4	527	6	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|B9JBA2|BETA_AGRRK	1.42e-63	13	534	4	532	Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=betA PE=3 SV=1
sp|A7MFA8|BETA_CROS8	4.84e-62	12	525	3	529	Oxygen-dependent choline dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	2.19e-61	10	535	3	538	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q1QXE1|BETA1_CHRSD	1.35e-60	12	525	7	533	Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000002

TMHMM  Annotations     

There is no transmembrane helices in FOZG_16722-t36_1-p1.