CAZyme Information: FOZG_16185-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_16185-t36_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
496	JH717910.1|CGC3	54331.28	8.8634

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717910.1:56196-57784(-)

Full Sequence      

MVSFLLICLQAALALAASTSPANTSTALSNCLASKKVPYIRPNSPQWTQEVRPYNLRLAY
TPAAIALPTTVDHVQDAVKCGNQYQVRVSAKSGGHSYGSFGYGGENGHLVIVLDSMDQVT
LNKYMSCNIQAGARLGHVASELYKLGQRAIPHGSCPGVGIAGHALHGGYGFASRTYGLTL
DTFIGATVILANGTRTYAADGEGGDNQLMWALRGAGSSYGIVVELDFQTIKAPDTVTPFS
IELDWNENQAVEGLIAFQKFAVTAPKQLNMQIYIGPSGQTIQGVYYGTRVALNTALKPFL
GDIKAQISASSTGGWIEGLKAYANGQNLDQRRPYNQHSTFYSTSLMTKAITRSQVKSFVR
TLFDNIKDSDARHSWYILIDLFGGPKSAITTAGSTNSAFPHRDKLLLFQFSDHGNYASHA
NNGFTLLKRFRESITKTMDDSDWGMYANYLDTQLENREAVEQYYELSLGRLRELKRAYDR
NDMFWNPQGIRPATRG

Enzyme Prediction     

EC	1.1.3.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	53	490	1.3e-74	0.9868995633187773

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	2.45e-24	62	194	1	134	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	8.49e-22	60	493	30	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	5.70e-09	446	491	2	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59370.1|AA7	0.0	1	496	1	512
QGI68899.1|AA7	0.0	1	496	1	496
QGI99788.1|AA7	0.0	1	496	1	496
QGI86269.1|AA7	0.0	1	496	1	496
CCT73375.1|AA7	0.0	1	496	1	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YJO_A	2.54e-275	5	494	7	505	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
6Y0R_AAA	1.59e-133	15	494	13	492	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
5K8E_A	1.11e-126	17	493	16	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	1.98e-112	27	493	2	472	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
1ZR6_A	1.21e-106	31	494	12	480	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2K2|CHITO_GIBZE	8.17e-133	15	494	13	492	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	4.50e-131	27	495	28	494	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|E9F5F1|SUBF_METRA	3.60e-130	27	495	28	494	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	5.71e-126	17	493	16	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	7.07e-112	17	493	14	494	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999752	CS pos: 16-17. Pr: 0.9514

TMHMM  Annotations     

There is no transmembrane helices in FOZG_16185-t36_1-p1.