CAZyme Information: FOZG_16130-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_16130-t36_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	JH717909.1|CGC6	36743.44	6.1124

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717909.1:752689-753753(-)

Full Sequence      

MKTTTYVSALLSLASAVSAHYTFDKLTLAGVQQGTDNEYIRKHQNGYMPTKFKNIPDGSI
SPTDKDFTCNKGSTPSANVFKVKAGDEIGLKQAFGGTGMKHPGPIQVYAAPVKDATSDSP
YDLKWYKIHQALICKSGNAESLRSTAWCSWGEDSVHFKIPSTLPDGQYLIRGEHIGLHGA
HDGQAEFYYACAQVEVSGNSATTIPGTSVSIPGVYKQDDAAVNFSLWGSSTSYDVMPGPD
VIPGGTIRGSADGAGGDVTKTVEGGADTGSDSGSDASPTEGSAAPSSTPTSAPEPSQAPV
VPDVPDSAETTPQPTPVAAETTPLPSAGNGASNGCSSGSSKARRHARHFAAHRF

Enzyme Prediction     

No EC number prediction in FOZG_16130-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA9	8	228	5.7e-55	0.9863636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
410622	LPMO_AA9	6.82e-65	20	242	1	216	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 9 (AA9). AA9 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs) involved in the cleavage of cellulose chains with oxidation of carbons C1 and/or C4 and C6. Activities include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54) and lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56). The family used to be called GH61 because weak endoglucanase activity had been demonstrated in some family members.
397484	Glyco_hydro_61	2.62e-56	21	233	1	211	Glycosyl hydrolase family 61. Although weak endoglucanase activity has been demonstrated in several members of this family, they lack the clustered conserved catalytic acidic amino acids present in most glycoside hydrolases. Many members of this family lack measurable cellulase activity on their own, but enhance the activity of other cellulolytic enzymes. They are therefore unlikely to be true glycoside hydrolases. The subsrate-binding surface of this family is a flat Ig-like fold.
184923	PRK14959	1.59e-05	239	352	363	488	DNA polymerase III subunits gamma and tau; Provisional
273167	rad23	9.95e-05	258	340	74	155	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
236776	PRK10856	2.25e-04	266	340	169	253	cytoskeleton protein RodZ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61928.1|AA9	3.03e-209	1	354	1	354
QGI68366.1|AA9	1.60e-198	1	354	1	358
QGI99259.1|AA9	1.60e-198	1	354	1	358
QGI85581.1|AA9	1.86e-197	1	354	1	358
CCT72729.1|AA9	6.69e-180	1	354	1	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI8_A	1.84e-22	20	241	1	211	Lytic polysaccharide monooxygenase 9F from Neurospora crassa, NcLPMO9F [Neurospora crassa],4QI8_B Lytic polysaccharide monooxygenase 9F from Neurospora crassa, NcLPMO9F [Neurospora crassa]
4D7U_A	4.66e-22	20	244	1	221	The structure of the catalytic domain of NcLPMO9C from the filamentous fungus Neurospora crassa [Neurospora crassa OR74A],4D7U_B The structure of the catalytic domain of NcLPMO9C from the filamentous fungus Neurospora crassa [Neurospora crassa OR74A],4D7V_A The structure of the catalytic domain of NcLPMO9C from the filamentous fungus Neurospora crassa [Neurospora crassa OR74A],4D7V_B The structure of the catalytic domain of NcLPMO9C from the filamentous fungus Neurospora crassa [Neurospora crassa OR74A]
4B5Q_A	9.95e-22	20	239	1	210	Chain A, GLYCOSIDE HYDROLASE FAMILY 61 PROTEIN D [Phanerodontia chrysosporium],4B5Q_B Chain B, GLYCOSIDE HYDROLASE FAMILY 61 PROTEIN D [Phanerodontia chrysosporium]
7EXK_A	1.37e-21	20	244	1	217	Chain A, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_B Chain B, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_C Chain C, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_D Chain D, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_E Chain E, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_F Chain F, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B]
3EII_A	2.72e-19	20	241	1	205	Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_B Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_C Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_D Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_A Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_B Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_C Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_D Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1C4H2|EGLD_ASPCL	1.14e-26	1	251	1	241	Probable endo-beta-1,4-glucanase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=eglD PE=3 SV=1
sp|B0Y9G4|EGLD_ASPFC	1.41e-25	1	250	1	240	Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglD PE=3 SV=1
sp|Q4WBU0|EGLD_ASPFU	1.41e-25	1	250	1	240	Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglD PE=3 SV=1
sp|A1DBS6|EGLD_NEOFI	6.92e-25	1	244	1	234	Probable endo-beta-1,4-glucanase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglD PE=3 SV=1
sp|B8MXJ7|EGLD_ASPFN	2.36e-24	1	244	1	234	Probable endo-beta-1,4-glucanase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=eglD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999655	CS pos: 19-20. Pr: 0.9623

TMHMM  Annotations     

There is no transmembrane helices in FOZG_16130-t36_1-p1.