CAZyme Information: FOZG_15771-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_15771-t36_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
922		102346.11	5.1852

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717908.1:1301121-1304187(-)

Full Sequence      

MLSHWGWHAPNNETLDFETGAHDYEHAFDIAHELGLYVVYRPGPYSNAEANGGKFPGWLT
TGEFGPLRDDNAAYTKAWERYSKAVAEYVRPYLITNGGPVIMWQIENEYGNQWLDPETKK
PKNTAIHYMELLEGKTRDWDIDVPFTANNPNMWTRSWSKDYGNVGGEVDMYGLDHYPACW
TCNLAQCIGVNGVVKPYTVFDYYSHFKAVSPTQPSFLMEFQGGSFNPWDVPEGGCSENMG
PDWVNLFYRHNLAEKVTAVNIYMAYGGTNWGNIGFPEVGTSYDYSAPIHENRLIGDKFNE
GKLFGLFVRVARDFVKVNRVGNSTDYTTDEDIFTSELRNADTNAAYYVVRHQDSTSTAET
KFRLKVSTEAGNLTVPTSGSITLKNRESKVLVSDFSIGASRKKSTYATLEILTAVDLGDR
QVVVFWAPDGEQGEFLLKGATSAKFMSGKGDKKSFTKTKNGIVANVVAGEEMSVIDFSNH
VEAVVVDRRSAYKFWAPTLDNNPLAWENSTGDGPYLVRSASIKGDTININGDWDEETTVE
IWAPNTIRKVSFNGEKLQVTKSKYGSFIGTLPAPDITVESFTSSLPSLSHWKVTEGLPEV
AADYDDSRWTDADHETTPHFVPPDTYPVLFADEYGYQAGNILWRGRFNATKGDEPTGAYL
RVIGGLASGFSVYVNGKFLGAWLGSMTNKTGKLAVSFQGVKFNTEEANILFVIQDTMGKE
QREAAPDPRGILNATLVAADGSAANFTSWKVTGNAGTNHLIDPVCGTRNEGGLHAERLGW
HLPGYDDNKWKTGSPSYGFKGATARFYRTVVPLDVPKGYDASLSFTLHTEKKAKLRAQLY
INGYQYGKTLPYISNETTFPVVPGILNYQGDNTIGLNIWAMDEAGGSMGVNWKVDGVYRS
RFSPLFNAEYLQPGWEDRSQCA

Enzyme Prediction     

EC	3.2.1.-:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	4	302	9.4e-59	0.8371335504885994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.37e-62	4	300	46	310	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	1.64e-58	316	493	3	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	1.70e-44	313	494	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	8.63e-34	774	884	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
404273	BetaGal_dom3	1.67e-24	513	568	10	65	Beta-galactosidase, domain 3. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61358.1|GH35	0.0	1	922	505	1444
QMW34558.1|GH35	0.0	1	922	82	1005
QRD93645.1|GH35	0.0	1	922	82	974
QMW46613.1|GH35	0.0	98	922	256	1082
UDD63503.1|GH35	0.0	129	922	1	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	3.40e-163	20	888	73	938	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	3.70e-163	20	908	113	988	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	1.02e-162	20	908	113	988	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	1.84e-145	28	889	121	973	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	8.39e-141	20	905	93	981	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6RPN7|BGALB_BOTFB	0.0	1	922	86	1007	Probable beta-galactosidase B OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=lacB PE=3 SV=1
sp|A7EBU5|BGALB_SCLS1	8.35e-314	1	917	86	1002	Probable beta-galactosidase B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=lacB PE=3 SV=1
sp|A1D199|BGALB_NEOFI	4.10e-308	1	917	89	1009	Probable beta-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacB PE=3 SV=1
sp|B0XNY2|BGALB_ASPFC	6.08e-305	1	917	89	1009	Probable beta-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacB PE=3 SV=1
sp|Q4WRD3|BGALB_ASPFU	6.08e-305	1	917	89	1009	Probable beta-galactosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000012

TMHMM  Annotations     

There is no transmembrane helices in FOZG_15771-t36_1-p1.