CAZyme Information: FOZG_15552-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_15552-t36_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		47266.31	5.3252

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717908.1:850924-852291(-)

Full Sequence      

MKLFVSPLLALSCLIGNAVAAWPNGPFKTEGRWIVNANGDKISLAGANWPGHGEVMVPEG
LQYQSIKDVLSDIKSIGMNAIRLTFATELVDQIYANNGKDVDLKTAFEEGLGKENGTIIL
QKVLKNNPSFTAQTTRLEVYDAIAAECLRQQIYIDLDNHISEAKWCCGGTDGNTWWGDTQ
FNVDNWVRGGKYMAAHSKKWPAKITQSLRNEPREPTNNNALRDKSYNWSDLYKYMRQGAD
AVHEADPKAIIVISGMNYDTYVTPLYSGEKLQPGGEVFNRDDFVGYGKDKLVLEIHNYEN
KGTSCSSLRYNLYNKGFQAMNESDPNVAEVFPVMLTEFGQAMNGADYDTANTYVSCLSEY
LPEIKASWFIWVIVGRYYTRQGIQEFDDSWGMKKADWSGWKNDDYIAKYLKPQIAGTLKK

Enzyme Prediction     

EC	3.2.1.164:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	34	373	1.6e-158	0.9940652818991098

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	9.96e-05	35	371	1	266	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61547.1|GH5_16	0.0	1	420	1	420
BAF42338.1|GH5_16|3.2.1.164	0.0	1	420	1	420
CEI70508.1|GH5_16	3.40e-292	1	420	1	420
QPC80202.1|GH5_16	4.65e-292	1	419	1	419
CZS85807.1|GH5_16	5.42e-291	1	419	1	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VRX_A	1.26e-10	25	407	4	348	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
1ECE_A	1.69e-10	25	405	4	336	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0HLA0|GH5FP_CHAOB	4.06e-48	8	408	11	390	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P54583|GUN1_ACIC1	2.60e-10	5	405	20	377	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|Q05332|GUNG_ACET2	2.84e-06	30	417	48	447	Endoglucanase G OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000276	0.999692	CS pos: 20-21. Pr: 0.9832

TMHMM  Annotations     

There is no transmembrane helices in FOZG_15552-t36_1-p1.