CAZyme Information: FOZG_13661-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_13661-t36_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		58403.18	6.2455

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717905.1:1821020-1822723(-)

Full Sequence      

MKSLPSILAVAAIPSLASGQSFQSTPVMGWNSYNQVSCSPNNKTIATAIEALSSRGFVDA
GYKFFQIDCGWASRDTQRDPTTGALKVDSNAFPDGLKPLSDLARSKGMKWTMYSDAGERM
CDPQYPSPVLGSLGHEAVDAAFFKSLNTEYLKYDNCYADSASNNAPKDPRTDFVTRFGTM
WSELQKVGIPGMLICQWGVPYSSSSGLEGPAEWTQSISTSFRLSDDIGEGWSNVYRISNQ
AIHIAHRNLSGPGHIADADLLEVGNSGMTFDEQATHFALWAMLKSALMISTDITALSAQT
VAVLQNKDLISINQDAAVKPISLVQRWTGDRDLWAGSLANGDIAVLYVDQSNSARTLSLQ
LSALGFQSADIKDLWTGKTSTGASSFSKQVNGHGSVALRLSNIKRVSSTANYKYTSLSTG
SLSSGAKTASCSGCTSSTKVGNLGGSSNGQVVLSNISTSKATQNVLFDYINGDVGFGGST
NERLASIKVNGGTAQTVSFPLTGYNWDKDVYKGYAVELSGFNTNGPNTITISGVNGGWAP
DFDRLAVIA

Enzyme Prediction     

EC	3.2.1.22:1	3.2.1.88:1	3.2.1.22:1	3.2.1.88:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	131	379	2.7e-59	0.9737991266375546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	8.82e-100	26	315	1	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
178295	PLN02692	6.58e-68	25	379	55	385	alpha-galactosidase
166449	PLN02808	2.43e-66	25	393	31	376	alpha-galactosidase
177874	PLN02229	6.74e-65	25	393	62	410	alpha-galactosidase
374582	Melibiase_2	1.96e-47	25	315	1	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD63095.1|CBM35|GH27	0.0	1	549	1	549
BAH10649.1|CBM35|GH27|3.2.1.22|3.2.1.88	0.0	1	549	1	549
QGJ01397.1|CBM35|GH27	0.0	1	549	1	551
QGI70507.1|CBM35|GH27	0.0	1	549	1	551
QGI87861.1|CBM35|GH27	0.0	1	549	1	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F4C_B	2.10e-56	25	379	8	338	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
1UAS_A	4.12e-55	25	393	8	352	Chain A, alpha-galactosidase [Oryza sativa]
3A5V_A	7.31e-54	25	379	8	368	Crystal structure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]
1SZN_A	6.23e-49	26	398	12	408	Chain A, alpha-galactosidase [Trichoderma reesei],1T0O_A Chain A, alpha-galactosidase [Trichoderma reesei]
3LRK_A	1.33e-43	25	385	29	407	Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRL_A Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R2S6|AGALD_ASPNC	1.39e-72	7	406	15	407	Probable alpha-galactosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=aglD PE=3 SV=2
sp|A4DA70|AGALD_ASPFU	8.41e-70	25	400	30	400	Probable alpha-galactosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=aglD PE=3 SV=2
sp|B0YEK2|AGALD_ASPFC	8.41e-70	25	400	30	400	Probable alpha-galactosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=aglD PE=3 SV=2
sp|A1D9S3|AGALD_NEOFI	6.15e-69	5	400	12	400	Probable alpha-galactosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=aglD PE=3 SV=1
sp|Q0CVX4|AGALD_ASPTN	2.71e-64	25	400	33	397	Probable alpha-galactosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999736	CS pos: 19-20. Pr: 0.9774

TMHMM  Annotations     

There is no transmembrane helices in FOZG_13661-t36_1-p1.