CAZyme Information: FOZG_12878-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_12878-t36_1-p1
• CAZy Family: GH38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500		56150.22	5.9098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717905.1:60427-61980(-)

Full Sequence      

MLSESVAVWLLALSCTEIPRVLAQDPEGWYETHPNMARIKHVNQDTHQIVDEYGRTRFFH
GTNVVMKEAPWYRPFEWTPGVSSFGERDVQNMHDLGLNIVRLGHSWAGAEPVRGEYNQTF
LDIMKKQTKLAEEHGIYVLVDVHQDVLAKQLCGHGVPDWFVKKNWVTGFRRFPFPQKLKP
FTTDTNGFPSPQSQCNTIDWSLSYLSVAVGNAFGRLYNNFDGLGDAFAAYWKKLASEYVD
TTNIVGYNLLNEPWAGDTYADPTLLVPGVADRKALEGLWNRASKQIRTVDNDTLIWFEGT
TFDILSGFNNVPLGDGSKTVHSFHYYNPPQLGPLKDTLYNRHKDNVRLKTAGVLTELTFW
MGDDKQMAGVAEAVAATDASMVSWIGWAYENLYNGTSGKPYSELEKHYSRAYPAAIAGTP
TSFGFDATSGIFKLNFTSDPNIDAPTEIILPISTFPNGYEARVLPNGSLLQYKPNDRTLA
LFTSRALKQETEISVEISTK

Enzyme Prediction     

No EC number prediction in FOZG_12878-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	58	389	2.1e-146	0.9969135802469136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	1.13e-18	410	495	1	86	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	6.43e-10	50	389	1	268	Cellulase (glycosyl hydrolase family 5).
396834	Glyco_hydro_42	2.38e-08	72	149	2	86	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
224786	GanA	0.001	72	165	22	103	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
273363	3a01208	0.009	390	470	528	618	Conjugate Transporter-2 (CT2) Family protein. [Transport and binding proteins, Other]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62446.1|GH5_27	0.0	36	500	1	465
QGJ01570.1|GH5_27	0.0	1	500	1	500
QGI70680.1|GH5_27	0.0	1	500	1	500
CCT75388.1|GH5_27	0.0	36	500	1	465
QGI88025.1|GH5_27	0.0	1	500	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CCU_A	2.04e-28	34	463	36	446	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5CCU_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
5J14_A	3.75e-28	34	463	36	446	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J14_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_A Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
2OSW_A	1.78e-25	51	456	39	442	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	3.23e-25	51	456	39	442	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
6JYZ_A	7.19e-14	79	418	61	415	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9GV16|EGCSE_CYANO	1.16e-90	42	500	34	503	Endoglycoceramidase OS=Cyanea nozakii OX=135523 PE=1 SV=1
sp|Q6L6S1|EGCSE_HYDVU	7.99e-84	42	466	25	454	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1
sp|A0A3S5YBC7|EGCSE_RHOH1	2.43e-27	39	463	33	438	Endoglycoceramidase I OS=Rhodococcus hoagii (strain 103S) OX=685727 GN=REQ_38260 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999754	CS pos: 23-24. Pr: 0.9707

TMHMM  Annotations     

There is no transmembrane helices in FOZG_12878-t36_1-p1.