CAZyme Information: FOZG_12642-t36_5-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_12642-t36_5-p1
• CAZy Family: GH36
• CAZyme Description: GPI mannosyltransferase 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613		69454.29	9.2997

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717904.1:1592174-1594240(+)

Full Sequence      

MSSATVSRKVLDEARNKRNRSVFLRDIIVIRLINAWWIATFFQPDEFFQSLEPAWDLAFG
SRSGAWLTWEWKHQLRTSLHPALFAGVYLIVDFISSRILPIGILRAAILVAAPKALQAVI
AGLGDWYTWQLAVSIYGANSNVSFFALFLQLFNPWQWYCSTRTFSNSLETALTVMALYYW
PWELVSAAQTTKENPKPTPVLKSLWSLRASLCLAALAVVLRPTNVLIWATIVFFTLTRIS
LQGSSPLTISTVFALVREAILCGSLILVISIASDRLYFGFWTFPAYNFLNFNLSKSLAVF
YGRNPWHYYILQGLPLICTTSLPFAIMALYKSSAFASSTSQSNTLKTLAYTVFTTIGALS
LISHKEVRFIYPLLPALSILSAPVAASFFTFQPDATTNNPRPRPQIRNKHYLLAALGVNV
FLAGYLSFFHQTAPLNVLTYLRHEYERIHPDSVQLAQTSRFSVGPGKDEELFALFLMPCH
STPWRSHLVYPGLRAYALTCEPPLHTEPNTRERENYRDEADRFYDNPIPFLTSELFGPEK
PLAVPRYIVGFDGIEPWLQDFVKTPEAQALSLTQVRPVWKGFNGLFNEDWRRSGKMIVWD
TGIYDNAPPAKES

Enzyme Prediction     

No EC number prediction in FOZG_12642-t36_5-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	27	488	2.7e-108	0.9845758354755784

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215437	PLN02816	1.29e-68	15	562	34	512	mannosyltransferase
281842	Glyco_transf_22	8.74e-65	27	488	6	413	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD58395.1|GT22	0.0	1	613	1	613
QGI84229.1|GT22	0.0	1	613	1	613
QGI97878.1|GT22	0.0	1	613	1	613
QGI66992.1|GT22	0.0	1	613	1	613
CCT71266.1|GT22	0.0	1	613	1	613

PDB Hits     

FOZG_12642-t36_5-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4IB63|GPI10_GIBZE	0.0	1	612	1	612	GPI mannosyltransferase 3 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI10 PE=3 SV=1
sp|Q4WPG0|GPI10_ASPFU	9.21e-152	24	599	55	645	GPI mannosyltransferase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi10 PE=3 SV=1
sp|Q2UH15|GPI10_ASPOR	1.08e-120	27	599	61	627	GPI mannosyltransferase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi10 PE=3 SV=1
sp|Q5BCB9|GPI10_EMENI	1.38e-113	27	599	56	565	GPI mannosyltransferase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi10 PE=3 SV=1
sp|Q6BH65|GPI10_DEBHA	1.63e-85	27	599	49	546	GPI mannosyltransferase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI10 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000005

TMHMM  Annotations     

Start	End
21	43
77	94
101	123
127	149
210	232
247	269
276	293
308	330
342	364
369	391
411	433