CAZyme Information: FOZG_12642-t36_4-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_12642-t36_4-p1
• CAZy Family: GH36
• CAZyme Description: GPI mannosyltransferase 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439		49610.32	8.9237

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717904.1:1592921-1594240(+)

Full Sequence      

MALYYWPWELVSAAQTTKENPKPTPVLKSLWSLRASLCLAALAVVLRPTNVLIWATIVFF
TLTRISLQGSSPLTISTVFALVREAILCGSLILVISIASDRLYFGFWTFPAYNFLNFNLS
KSLAVFYGRNPWHYYILQGLPLICTTSLPFAIMALYKSSAFASSTSQSNTLKTLAYTVFT
TIGALSLISHKEVRFIYPLLPALSILSAPVAASFFTFQPDATTNNPRPRPQIRNKHYLLA
ALGVNVFLAGYLSFFHQTAPLNVLTYLRHEYERIHPDSVQLAQTSRFSVGPGKDEELFAL
FLMPCHSTPWRSHLVYPGLRAYALTCEPPLHTEPNTRERENYRDEADRFYDNPIPFLTSE
LFGPEKPLAVPRYIVGFDGIEPWLQDFVKTPEAQALSLTQVRPVWKGFNGLFNEDWRRSG
KMIVWDTGIYDNAPPAKES

Enzyme Prediction     

No EC number prediction in FOZG_12642-t36_4-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	1	314	1.2e-65	0.6401028277634961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	3.60e-35	1	314	143	413	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	2.74e-34	1	388	181	512	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD58395.1|GT22	0.0	1	439	175	613
QGI84229.1|GT22	6.00e-306	1	439	175	613
QGI97878.1|GT22	6.00e-306	1	439	175	613
QGI66992.1|GT22	6.00e-306	1	439	175	613
CCT71266.1|GT22	6.00e-306	1	439	175	613

PDB Hits     

FOZG_12642-t36_4-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4IB63|GPI10_GIBZE	3.88e-274	1	438	175	612	GPI mannosyltransferase 3 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI10 PE=3 SV=1
sp|Q4WPG0|GPI10_ASPFU	1.30e-84	29	425	243	645	GPI mannosyltransferase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi10 PE=3 SV=1
sp|Q2UH15|GPI10_ASPOR	1.78e-81	1	425	192	627	GPI mannosyltransferase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi10 PE=3 SV=1
sp|Q5BCB9|GPI10_EMENI	1.05e-72	81	425	215	565	GPI mannosyltransferase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi10 PE=3 SV=1
sp|Q6BH65|GPI10_DEBHA	2.16e-49	1	425	185	546	GPI mannosyltransferase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI10 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999971	0.000019

TMHMM  Annotations     

Start	End
36	58
73	95
102	119
134	156
168	190
195	217
237	259