CAZyme Information: FOZG_12198-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_12198-t36_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
762		85961.95	6.2812

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717904.1:505759-508238(+)

Full Sequence      

MWGSFVPAPGRIFFTDDPGNMALANDYGIVVSTSHHEPMQRASNEWKQSKNGAWDWVANK
GNVVEFMREGVRRAGGNDTYFTLGMRGENDGPIQADDPIAVLREVFAVQRNILASFYGNE
TAARQIWTIYKEVATYYAAGLEPPEDVTLMFTDDNWGNVQKLPNAKELGRSGGIGMYYHF
EYVGRPKSWKWQNCNNLPKIYKELFQAAQAGVNRIWVFNVGDIKPVELPLNMAMDLAWNA
TRFDLDSLPDYLQSLAARDFDLEHSEVIASAWLAYSHLVGMRKFEMLEPTTYSITNYEEA
DRILGAWKALADRVRAIEASLPQTHRDAFFHSSTYAAVAGYNYHAILIGQGKNRQYSFER
RNSANAIAYDLIERFEYDHDLTIEYDAIAGGKWRGIMSTPKFDMSTADWRPSSRDVMANL
SFVQLRQDFDYAFGNLGIYVEQSRAPYLQGRICASINPSKPTKDGLSPMMRPMEPHGPAF
RWIDLFHRGDHRRPIRWSISVPEPWINVSQVSGEVSGSKPEERVHISINWELVPATYNQT
VQLRVFYGPPAHFDDVHLPVINIRALKDFAGFPEVDGIISIEAPHYQRSSLTQDTGRNIG
FKVMPRLASRSESGSVALRPYQAAIESESESKASWLEYDIFILGNATRRAVNATIYINGA
LDTRANKPMLCSLSLQNESKPANDFFKILGTPEKAGDTPPEWNAEVANGVWTRTLQLGSL
SPGKHILRWQVNSPEVYLEKIVLATQGRLPETSLGPPETSRL

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	1	421	5.9e-138	0.569583931133429

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	1.09e-145	1	286	55	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	3.75e-36	571	758	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD58010.1|GH115	0.0	1	736	254	989
UQC81939.1|GH115	0.0	1	759	257	1017
BAE63119.1|GH115	0.0	1	758	247	968
UDD61142.1|GH115	1.65e-255	1	496	247	742
CDP27858.1|GH115	1.27e-233	1	759	249	1016

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	1.39e-101	13	761	224	935	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	1.95e-79	13	401	226	629	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.29e-77	13	401	225	628	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	5.63e-76	13	397	253	640	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	3.93e-67	7	759	215	963	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

FOZG_12198-t36_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOZG_12198-t36_1-p1.