CAZyme Information: FOZG_12103-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_12103-t36_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887	JH717904.1|CGC9	96691.03	7.9208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717904.1:220497-223305(-)

Full Sequence      

MALNRIKSHGPGHVAIDDVKIGNGPSSDVISDGRVRVQFHDNPQALATWCDRFQGSFAGE
LPGVEHLELSKPRRTNSIAFLPDVEKPTCGPRLNIAIHIVGSRGDVQPFIPIAQILMKPP
HGHRIRICTHPVFKDFVEAQGVEFFSIRGDPEALMAYMVKNPGLIPSRESFKGGEVGKRR
REMAEIINGAWRSCIEAGDGMGEGVTAANVQCAEDLFIADVIIANPPSMAHIHCAEKLSI
PLHMVFTMPWSPTKAFPHPLAAMSYGDADARVANYLSFMMTELLTWQGLGDLINKFRTQT
LHLDPVSPMWGYQLLSRLRVPYSYLWSESLLPKPFDWPSHLNITGFSFLPLAHSYTPPPD
LVEFLETGPIPIYVGFGSIVVDDPQALTQLIFQAIEIAGVRAIVSKGWGGVGAGGDVPDG
VYLIGNCPHDWLFQRVSVVVHHGGAGTTAAGIAAGQPTVIIPFFGDQPFWSQMVARAGAG
PTSVPFKELTAEILAESITLALQPEVQEVAQEMAGHIAEEDGAVQAAMDITDRLEVDKLR
CDICPERLATWLHRKTGAHLSGFTASCLVDQGLIQPADLKLLRHKHWYVDEGAEEPITGV
IAAASGFVAAVGTATSDYLQRLKIPAPPRPSRRRLSSKRHFTPTEEHQAHDGILRPVIGP
AALTTMEMENIAIRLATKSLRNGDPTIAASNIVPSIRNRHKASWRAHEEGKNGRAYYVIR
ATGRYACDLAKAGAKAPVALIYNVANGFHNAPSHGFAGIEVRRRDEITGLGSGLKTAGKE
FTLGIWEAFSGLVTKPYNDTKQRGARGLGKGMLRGGLGFISNLGSAIFGLPGYTLKGIEK
ELAKHHLTKLKGEVLLIRLRQGINDWREAPVEERQEAVRRWNALVSK

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	212	527	1.4e-55	0.7460732984293194

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.72e-61	93	527	1	398	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.18e-26	95	534	4	398	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	7.58e-17	95	257	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57931.1|GT1	0.0	1	825	1	819
UPK91708.1|GT1	0.0	1	884	1	883
CZS80737.1|GT1	0.0	1	885	1	886
QPC58826.1|GT1	0.0	1	876	1	877
QKD55584.1|GT1	0.0	1	884	1	889

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	8.15e-74	100	572	27	474	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.37e-73	100	572	47	494	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	7.17e-29	93	538	1	402	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	3.88e-27	93	527	1	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.92e-21	93	527	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	7.44e-120	91	526	191	602	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	8.31e-119	91	533	154	572	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	3.86e-76	76	480	980	1361	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q9Y751|ATG26_KOMPG	4.04e-75	92	538	760	1182	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1
sp|P0CN90|ATG26_CRYNJ	1.62e-74	75	561	1024	1497	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOZG_12103-t36_1-p1.