CAZyme Information: FOZG_11895-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_11895-t36_1-p1
• CAZy Family: GH30
• CAZyme Description: mannosyl-oligosaccharide alpha-1,2-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543	JH717903.1|CGC5	60937.32	4.7319

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717903.1:1811388-1813019(+)

Full Sequence      

MMLFSLVLCTFVLSAIASPSTPISEQKLGGLRYPKQRGKHYDYTGFEPSQKKRADDIIDM
FRFAWNGYYEHAFPHDSLRPKYNNYTDDRNGWGVTAVDGLDTAILMEQTDIVEIILDFIP
TINFTKTNTPEPTTVSLFETNIRYLGGLLSAYDLLKGPFKHLKVNKENVDVLLKQATTLA
DTLKFAFDTPSGIPFGSLWIENQTSTDENSLEDGTAYAGLAAMGTLVLEWQHLSDLTGDP
QYGKLANRAESYWLSPSSEVWPGLTGGRFSLKTGEILDEYGGWTSGNDSAYEYLIKMYVY
DPDRFSHYGERFTMAADSTIKHLISHPSSRPDLTMAAAFTGRQQVNYTEFLACFIGGSFI
LGSSALDRPDWLDYGLSFSEYCANGYRYTASGIGPTLYSWDLNELAQPENKNQTAFYNRA
GFFIQEGIFQGGQAPEAVESWYYAYQKTHDQYWRDVAWAYTLAQNRTMRVGGGFASINNV
LSPSGDGVRGGIMASFMLAETLKYMWLIQTENKGEWDVLEGGENLFVYNTEAHPLRVAAK
KPV

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	60	537	1.3e-110	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.53e-143	60	537	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	9.76e-75	17	540	30	521	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60002.1|GH47	0.0	2	543	1	542
CCT73980.1|GH47	0.0	2	543	1	542
QGI69595.1|GH47	0.0	2	542	1	541
QGJ00483.1|GH47	0.0	2	542	1	541
QGI86948.1|GH47	0.0	2	542	1	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	6.30e-152	49	538	1	474	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	1.47e-151	20	538	6	509	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	2.12e-135	53	537	15	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	2.21e-40	50	537	20	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
5KIJ_A	2.27e-40	53	537	5	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CP08|MNS1B_ASPCL	5.33e-151	53	537	35	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|P31723|MAN12_PENCI	7.55e-151	20	538	6	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|Q0D076|MNS1B_ASPTN	3.55e-148	16	537	3	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	8.66e-145	15	539	14	512	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|Q2ULB2|MNS1B_ASPOR	1.01e-142	49	539	36	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999762	CS pos: 17-18. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in FOZG_11895-t36_1-p1.