CAZyme Information: FOZG_11245-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_11245-t36_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		36820.23	9.3585

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717903.1:131364-132429(-)

Full Sequence      

MHFAYPPRKNSNPPPFKQRSSQIPPILRRIRKRTALLLLLGAVGFIFFLFGLKGETPYRE
HVPSGNPPVVVVTVLDNTQYSDTYLESIRHNREQYALRHGYEAMIVQATDYDTGKSPRSW
AKIIAMRHALSKYPDTTYVWFLDQNAYIMELDKKLEEQVMNPAKLESLMIKDWSIVPPDS
IIKTFSHLKGEDAGLVISQDEAGLVTNSYILKNGEWAKFFIETWMDPLYQSYNFQKAERH
ALEHIVQWHPTILSKLALIPQRTFASYGRNKEGNAYRDGDFVTLLVDCTVTGPTSCDKQS
HFYLQQLKNKFGDASVKKLQ

Enzyme Prediction     

No EC number prediction in FOZG_11245-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	67	292	1.9e-70	0.9715447154471545

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	9.56e-71	65	292	1	236	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	0.003	91	236	156	278	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59427.1|GT34	8.51e-240	1	320	1	320
QGI86320.1|GT34	9.41e-228	1	320	1	320
QGI68949.1|GT34	9.41e-228	1	320	1	320
CCT74016.1|GT34	9.41e-228	1	320	1	320
QGI99838.1|GT34	9.41e-228	1	320	1	320

PDB Hits     

FOZG_11245-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	1.11e-38	28	308	5	311	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	3.34e-31	84	290	123	335	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	4.09e-26	84	312	123	355	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|P46985|MNN11_YEAST	3.25e-24	54	308	147	420	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|P50108|MNN10_YEAST	4.16e-20	91	288	152	362	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000010	0.000016

TMHMM  Annotations     

Start	End
35	52