CAZyme Information: FOZG_11099-t36_2-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_11099-t36_2-p1
• CAZy Family: GH3
• CAZyme Description: mannan polymerase II complex ANP1 subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280		32039.00	9.7822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717902.1:1884119-1885014(-)

Full Sequence      

MLLPGGGLNWKAAKAQMPPSRVLRSNLTRSRLLLLIGVTSIVMLLYRSFRAPPPGPQNVR
CWGPNKSPMEMTPNEHALWNAHMQTPVLFNHHKPLKVESPSIQHIDLNPITSSPQALIRN
ERVLILTPLKDAAPFLKNYFKLIAELTYPHRLIDLAFLISDSKDDTLAVLASELDHLQKR
KDEVPFNSITVVEKNFHFHLSQDAEQRHGFEVQAPRRKAMAKARNYLLATALKPEHSWVY
WRDVDIEQAPRRIIEDFVAHDRDILVPSKSLEADSETSWH

Enzyme Prediction     

No EC number prediction in FOZG_11099-t36_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	100	268	1.8e-65	0.6380597014925373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	4.17e-94	101	267	1	170	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD54422.1|GT62	5.18e-191	1	268	1	268
QGI95386.1|GT62	6.02e-190	1	268	1	268
QGI64501.1|GT62	6.02e-190	1	268	1	268
QGI81760.1|GT62	6.02e-190	1	268	1	268
CCT68569.1|GT62	6.02e-190	1	268	1	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	5.47e-23	102	265	6	168	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	8.02e-45	121	268	98	246	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	1.45e-43	88	268	48	229	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	2.70e-29	101	268	171	386	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	2.04e-27	101	268	75	293	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	2.06e-25	102	265	73	234	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000010	0.000009

TMHMM  Annotations     

There is no transmembrane helices in FOZG_11099-t36_2-p1.