CAZyme Information: FOZG_10497-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_10497-t36_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253		27374.04	5.6846

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717902.1:369199-370066(-)

Full Sequence      

MVFPKVLFLSTLSGIAAVTSAESGCRCGDSAYLAIPRVNLSTPEQLKPCATYKLLDARGS
GEPQGVSLMFQNTIQRILANNTGAVSQAVVYPAGFDQNVTSGVKFVTDIIKYGLQDCPKQ
KYFLFGYSQGATVVQRALSELDDASMAAVSSVVMVGNPYRTPGRLSNYDSQGHRDNRIAY
GLFAVQSLQSNDSILTFNDGVDRSGKVADICLENDIVCSFDPNCTCQLASDHLSYGLMKP
VQDQIFDHVISRL

Enzyme Prediction     

No EC number prediction in FOZG_10497-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	48	252	3.2e-28	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.20e-15	48	253	1	173	Cutinase.
369775	PE-PPE	1.27e-07	83	160	2	91	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53881.1|CE5	2.33e-183	1	253	1	253
CCD43917.1|CE5	6.54e-65	51	253	28	230
ATZ47831.1|CE5	9.64e-53	51	213	28	190
AQA29319.1|CE5	6.72e-29	49	253	20	222
UJO18208.1|CE5	6.72e-29	49	253	20	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CC4_A	3.06e-27	49	242	3	185	Chain A, Cutinase-like enzyme [Moesziomyces antarcticus],7CC4_B Chain B, Cutinase-like enzyme [Moesziomyces antarcticus],7CW1_A Chain A, Cutinase-like enzyme [Moesziomyces antarcticus],7CW1_B Chain B, Cutinase-like enzyme [Moesziomyces antarcticus]
2CZQ_A	1.86e-20	49	253	6	201	A novel cutinase-like protein from Cryptococcus sp. [Cryptococcus sp. S-2],2CZQ_B A novel cutinase-like protein from Cryptococcus sp. [Cryptococcus sp. S-2]
4PSC_A	2.75e-14	48	159	78	195	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A8QPD8|CUTI1_TRIHA	1.92e-14	8	170	37	205	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|A0A024SC78|CUTI1_HYPJR	1.31e-13	48	159	78	195	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1
sp|G0RH85|CUTI1_HYPJQ	1.31e-13	48	159	78	195	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2
sp|Q9Y7G8|CUTI_PYRBR	4.65e-09	38	158	21	148	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1
sp|C8VJF5|CUTI4_EMENI	3.71e-06	49	161	60	174	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000341	0.999623	CS pos: 21-22. Pr: 0.9329

TMHMM  Annotations     

There is no transmembrane helices in FOZG_10497-t36_1-p1.