CAZyme Information: FOZG_10251-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_10251-t36_1-p1
• CAZy Family: GH20
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851	JH717901.1|CGC5	92641.35	4.9304

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717901.1:1962924-1965682(+)

Full Sequence      

MGDISALQTVEEHAQHELGLDVEQVLKQLTTVEKIDLLAGIDFWHTKAIPRLGIPSIRMS
DGPNGVRGTRFFNGVPAACFPCGTGLAATWNTELLHQAGSLMGSEARAKGVHVLLGPTVN
MQRSPLGGRAFESFSEDPVLAGYCAASIVAGIQETGVVASIKHFVANDQEHERMAVDSLV
TERALREIYTLPFQIAVRDANPGSFMTSYNKVNGTHVSDNKDMIEKVVRGEWGWEGLVTS
DWYGTYSTVESVEAGLDIEMPGPTRWRGQMLLHALMSRKIDLETVNERVRQVLKLVDRAI
RTGVPSNAPEVSQNTPETAALLRRIAGESIVLLKNDHNALPFNRGETVAVIGANAKTAVF
CGGGSATLRPYYAVSPFQGITNKADDVRYSVGCYAHKMLPVLGPRLKTVDGQPGVAFRAF
TSPESDHGRQPVDELLLDSTDMYFADYYHPKITEDLWYGEIEATFEADETCDFEFGLCVF
GTARLYVDGELLIDNETAQRSGGSFFNVGTVEETGIKKVTAGQTYKINVVFASGAASKLG
DNEGVVSYGSGGLRIGGAKVIVPDEEIANAVQLASSVDQVVLCVGLNSDFEQEGHDRSHI
DLPGRTDELVAAVAKVNPRTVVVVQSGSPVSMPWANDVAAVIQAWYGGNETGNAIADVLF
GDVNPSGKLPLSFPTRIEDNPAFLNYRSEHGRVLYGEDVYVGYRYYETVKKPTLWSFGSG
VSYTTFSLSNLQIQQRPGKHGQLLLIDVTVENVGQVDGAEVVQVYVSQRTPSINRPVKEL
KGFSKVSVEAGKSSVARIVIDRKYATSYWDETRHKWTEEGGIYDLLVGTSSRDTPLTGMF
EVADTTWWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	47	261	5.1e-69	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.82e-81	51	834	101	757	beta-glucosidase BglX.
224389	BglX	5.51e-71	42	386	48	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.30e-58	330	703	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	7.12e-51	29	801	60	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.05e-40	51	295	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55191.1|GH3	0.0	1	851	1	851
UPK92097.1|GH3	0.0	1	851	1	846
UQC79070.1|GH3|GH78	0.0	5	847	23	865
UQC84651.1|GH3	0.0	21	851	5	833
CCD50485.1|GH3	0.0	21	851	6	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.92e-268	21	851	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.60e-264	21	851	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.28e-152	18	845	1	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.74e-128	26	833	9	654	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.24e-107	22	844	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	20	851	4	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	0.0	22	851	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	0.0	21	851	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	0.0	20	851	4	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q4WLY1|BGLJ_ASPFU	0.0	22	851	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000002

TMHMM  Annotations     

There is no transmembrane helices in FOZG_10251-t36_1-p1.