CAZyme Information: FOZG_10177-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_10177-t36_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	JH717901.1|CGC10	37959.45	4.5937

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717901.1:1795725-1796807(-)

Full Sequence      

MASLISTLSILALAATHAFSHVIMVEPHPFNLDTEPLYQTWPLSEDLPFPCQGRTQHPEQ
VTKVTAGKTQLVKFWGSAVHGGGSCQFSVAYGKEPPKDPKKWHTIYSIIGGCPAEAEGNI
ASTGTDPHGRENGNECGNDTGKECTKQFNIPIPKDMQNGPATFAWTWFNKIGNREMYMVC
SPIEVVGGKDDSSYVDTLPAIFRANIPGECTTGASGSVINFPEPGDFGKIYEQGTPGSEG
TCAKGVEPNFKDDAAAPEPEKLAESGSPAPAPEQPSAPAKPSVVQPPAQSTDAPAPVDSA
KPEAGAPAWSGEFQACPSDVKSGMMHCFSETTWGICNGGWAFVSKVAEGTKCIDGAIAAE

Enzyme Prediction     

No EC number prediction in FOZG_10177-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	21	227	5.5e-64	0.9476439790575916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411490	pneumo_PspA	8.75e-06	254	342	365	454	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
237030	kgd	1.29e-04	234	307	42	115	multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.
237865	PRK14951	2.60e-04	254	308	390	443	DNA polymerase III subunits gamma and tau; Provisional
237865	PRK14951	6.13e-04	254	308	375	429	DNA polymerase III subunits gamma and tau; Provisional
240289	PTZ00144	6.57e-04	221	303	102	188	dihydrolipoamide succinyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55128.1|AA11	1.60e-271	1	360	1	360
CCT69101.1|AA11	9.23e-235	1	360	1	409
QGI65138.1|AA11	4.91e-228	1	360	1	401
QGI96022.1|AA11	4.91e-228	1	360	1	401
QGI82391.1|AA11	4.91e-228	1	360	1	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	3.13e-36	21	227	1	198	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

FOZG_10177-t36_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999737	CS pos: 20-21. Pr: 0.9152

TMHMM  Annotations     

There is no transmembrane helices in FOZG_10177-t36_1-p1.