CAZyme Information: FOZG_09478-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_09478-t36_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		65943.42	6.5620

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717900.1:3743506-3745483(-)

Full Sequence      

MHILPVLCSLLASALAEDVPPQFDDGQLTGNGFGIPGINATYDYVIVGGGTAGALAAARL
TEHSNATVALVEAGGFYELSNGNVSQLPFRINDWKGSGGASSWQPLIDWGYFTQPQNNGK
KIHYAQGRTFGGSSARNLMMFNRPTKGAYKHWAEKVGDDAYTWENMLKFNTRTMKFSDNS
QHRPQNATALYDTAAFSEKGGPLHLTFPGYVFPVSWDAIKAFEALGFKEIPSFTAGALQG
WGWWQFSINPETGLRDSSESSFLQQSLGRPRLTTYINTMARKILFSGKKAVGVTVDNYGQ
QSFNLTARREVIVAAGLWSSPQLLMVSGVGPEETLKKFDIPVLSNLPGVGQGTHDSAAVH
GPIWEIEGISTGGWKQPSKMKEAITEFNQHKKGPLTNGGVDVGAFEKIPLANLSKKAQED
LAQYPEDWPEVEFIMQMVDPPAGATGKNYAAMTIRMVGTVSRGNMTISSASNLDPPIIDP
NWLRADTDKEVALYALRRARQLWEHIPSKIGKEIYPGASITSDEHLLDLTYDNLDPTHHG
TASCSMGKAGDPSAVVDSKGRVFGVKNLRVIDSSTMPLTPPGHTMGPTYGNAEKLVQDIL
NAYHGLE

Enzyme Prediction     

No EC number prediction in FOZG_09478-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	41	601	1.2e-155	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.64e-69	38	602	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.35e-67	41	600	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.81e-40	461	595	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.68e-20	118	331	15	204	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.80e-18	268	585	230	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56657.1|AA3_2	0.0	1	607	1	607
CCT70719.1|AA3_2	0.0	1	607	1	607
QGI97424.1|AA3_2	0.0	1	607	1	607
QGI83776.1|AA3_2	0.0	1	607	1	607
QGI66534.1|AA3_2	0.0	1	607	1	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS1_AAA	6.60e-53	42	594	8	555	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.73e-52	42	594	8	555	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	1.73e-52	42	594	8	555	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	2.26e-52	42	594	24	571	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	3.30e-52	42	594	8	555	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	1.34e-145	27	602	37	627	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	9.48e-143	27	599	38	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A4UHS8|VBSA_DOTSE	3.71e-138	4	600	31	644	Versicolorin B synthase OS=Dothistroma septosporum OX=64363 GN=vbsA PE=2 SV=2
sp|M2Y151|VBSA_DOTSN	3.71e-138	4	600	31	644	Versicolorin B synthase OS=Dothistroma septosporum (strain NZE10 / CBS 128990) OX=675120 GN=vbsA PE=2 SV=1
sp|Q5B8A1|PKFF_EMENI	7.89e-137	3	599	6	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000529	0.999438	CS pos: 16-17. Pr: 0.9686

TMHMM  Annotations     

There is no transmembrane helices in FOZG_09478-t36_1-p1.