CAZyme Information: FOZG_08874-t36_3-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_08874-t36_3-p1
• CAZy Family: GH16
• CAZyme Description: N-acetylglucosamine-6-phosphate deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	JH717900.1|CGC13	39584.80	6.3808

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717900.1:2124947-2126100(+)

Full Sequence      

MTCPNMAKTSKRSIGYWSRQGSHHTSQPSPVNGLNYTKRYAFLFGGAIVHEANACQALPY
LGPSGELRIPAHGAESLGAHCEGPFLSPTKNGVHNVDVLTQAESIEDIEQCYGRENITPR
SDGAPMPIKMITAAPERGQMMNLIPEITSRGIIYSVGHTEATYEETSQAVSKGATMITHL
FNAMRPLHHRNPGVFGVLGKAESLPRPYFGIISDGIHLHPTTIKIAYSAHPDGFILVTDA
MHLVGLPDGAYPWTNGEYTCNIVKQGSKLLLENSDTIAGSSITLLECVNNFRQWTGASIP
QALGAVTSTPAAMLGLQGVKGSLESGADADLVILSDGYERQGEVRGTNEVLVLDEVWKFG
ERVSDSAK

Enzyme Prediction     

No EC number prediction in FOZG_08874-t36_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE9	69	339	3.7e-90	0.67828418230563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238434	NagA	2.85e-103	55	339	102	366	N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate. This is the first committed step in the biosynthetic pathway to amino-sugar-nucleotides, which is needed for cell wall peptidoglycan and teichoic acid biosynthesis. Deacetylation of N-acetylglucosamine is also important in lipopolysaccharide synthesis and cell wall recycling.
224733	NagA	4.06e-85	71	339	116	367	N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism].
272968	nagA	1.37e-58	73	339	122	371	N-acetylglucosamine-6-phosphate deacetylase. [Central intermediary metabolism, Amino sugars]
183010	nagA	4.50e-43	72	351	121	380	N-acetylglucosamine-6-phosphate deacetylase; Provisional
224149	HutI	4.31e-09	296	368	335	405	Imidazolonepropionase or related amidohydrolase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56116.1|CE9	2.34e-228	56	368	127	439
QGI96894.1|CE9	8.88e-225	56	368	127	439
CCT70158.1|CE9	8.88e-225	56	368	127	439
QGI66012.1|CE9	8.88e-225	56	368	127	439
QGI83251.1|CE9	8.88e-225	56	368	127	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NUT_A	5.01e-55	72	341	133	392	Chain A, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUT_B Chain B, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUU_A Chain A, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUU_B Chain B, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens]
2VHL_A	2.81e-38	73	339	127	376	The Three-dimensional structure of the N-Acetylglucosamine-6- phosphate deacetylase from Bacillus subtilis [Bacillus subtilis],2VHL_B The Three-dimensional structure of the N-Acetylglucosamine-6- phosphate deacetylase from Bacillus subtilis [Bacillus subtilis]
3EGJ_A	1.55e-35	75	347	124	372	N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae. [Vibrio cholerae],3EGJ_B N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae. [Vibrio cholerae],3IV8_A N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae complexed with fructose 6-phosphate [Vibrio cholerae],3IV8_B N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae complexed with fructose 6-phosphate [Vibrio cholerae],3IV8_C N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae complexed with fructose 6-phosphate [Vibrio cholerae],3IV8_D N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae complexed with fructose 6-phosphate [Vibrio cholerae]
6FV3_A	1.38e-30	78	334	134	376	Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_B Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_C Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_D Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155]
1O12_A	6.52e-30	77	344	122	371	Crystal structure of N-acetylglucosamine-6-phosphate deacetylase (TM0814) from Thermotoga maritima at 2.5 A resolution [Thermotoga maritima],1O12_B Crystal structure of N-acetylglucosamine-6-phosphate deacetylase (TM0814) from Thermotoga maritima at 2.5 A resolution [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6P0U0|NAGA_DANRE	2.21e-59	66	336	124	387	N-acetylglucosamine-6-phosphate deacetylase OS=Danio rerio OX=7955 GN=amdhd2 PE=2 SV=1
sp|Q9VR81|NAGA_DROME	7.50e-56	68	336	138	398	N-acetylglucosamine-6-phosphate deacetylase OS=Drosophila melanogaster OX=7227 GN=CG17065 PE=2 SV=1
sp|A7MBC0|NAGA_BOVIN	6.65e-55	72	336	133	387	N-acetylglucosamine-6-phosphate deacetylase OS=Bos taurus OX=9913 GN=AMDHD2 PE=2 SV=1
sp|Q9Y303|NAGA_HUMAN	2.58e-54	72	341	133	392	N-acetylglucosamine-6-phosphate deacetylase OS=Homo sapiens OX=9606 GN=AMDHD2 PE=1 SV=2
sp|Q8JZV7|NAGA_MOUSE	1.40e-53	72	336	133	387	N-acetylglucosamine-6-phosphate deacetylase OS=Mus musculus OX=10090 GN=Amdhd2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000003

TMHMM  Annotations     

There is no transmembrane helices in FOZG_08874-t36_3-p1.