CAZyme Information: FOZG_08850-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_08850-t36_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	JH717900.1|CGC23	58554.11	6.3611

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717900.1:2046493-2048152(+)

Full Sequence      

MHYILPLLASIVAVYANCPNYEQFARERHEPFSSGRHAFPFQRPGKDCRTYSVPAVEKVI
YEEMDQAIGDPDLYRLFLNTWPNTLDTTVKWQGTSADNSDEELAFITTGDINALWLRDSA
NQLQSYKSILSSNRGSPSDENDIASLFRGAINLQARYITKSPFCNAFHPPPEAKLRRVKR
SLQPRDTVSPKYDPDFVFECKYELDSLAAFLQLSWDYYDETEDGGFFGKFGWVEAVKAIL
RVAKHMQEGTYDEQGRVRKPAYTWLRNSDSASETVSNHGHGAPVKGHIGLVRSFFRPSDD
ACIYQYFIPANMMFSRYLTACAKIMRPLDEKVAKEMEALAFDIEVGVNKHAIIQHPIFGE
MYAYEIDGFGSHSLMDDANIPSLLSIPHLGYKPASQHVYDNTRAFVLSSYNPYYARGPVL
NATGGPHLGPGMAWPMGLIVQLLTSDDDKEIVDGIRQLMNSTSGLGLIHETVNSHNEKHW
TRSWFSWANGLFGQMIMDLYKRKPTLIARSYQGVDDK

Enzyme Prediction     

No EC number prediction in FOZG_08850-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	70	497	2.8e-156	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	70	497	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	4.15e-137	47	506	1	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56092.1|GH125	0.0	1	517	1	517
QGI65997.1|GH125	0.0	1	517	1	517
QGI96878.1|GH125	0.0	1	517	1	517
QGI83236.1|GH125	0.0	1	517	1	517
CCT70141.1|GH125	0.0	1	517	1	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	3.16e-88	43	512	21	463	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	3.61e-87	43	512	43	481	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.00e-85	43	512	23	461	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	5.94e-77	50	498	5	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	7.40e-77	50	498	5	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.11e-145	18	510	27	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999746	CS pos: 16-17. Pr: 0.9796

TMHMM  Annotations     

There is no transmembrane helices in FOZG_08850-t36_1-p1.