CAZyme Information: FOZG_08364-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_08364-t36_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	JH717900.1|CGC10	35866.52	5.7300

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717900.1:770831-771830(+)

Full Sequence      

MLSPAFAHRKYVYTASIAAVIVIFLTVNYAYSGRIRPSRLPEQDALPTAPATLQQEPFPH
KIWQSWKDDSENPTDRTVGFPHQWRAVNPDWRYERITDANNDAYVRDRFDANISDVFTSL
QDPILKADFLRYLILLREGGVWADIDVFPHQPVSRWIPKQFQGSVNLVVGIENDHHKQPI
WPGSSYSVQLCQYSVLAKPNHPGIKTLVNQVAEDLKKLLESKQPGEAVSFEDVMSTTGPF
AFTKVLMDYFKESTGVEHTGDELDRLEEPRLIGDVLVLPKDSFGWLPQEHTHDKGDPIIL
VEHLFIGSWRDGHPG

Enzyme Prediction     

No EC number prediction in FOZG_08364-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	83	159	3.5e-19	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.50e-20	55	254	79	248	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.38e-11	84	160	11	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	1.37e-04	84	207	72	184	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55670.1|GT32	3.10e-244	1	315	1	315
CCT69762.1|GT32	1.91e-229	1	315	1	315
QGI82842.1|GT32	1.91e-229	1	315	1	315
QGI96476.1|GT32	1.91e-229	1	315	1	315
QGI65596.1|GT32	1.91e-229	1	315	1	315

PDB Hits     

FOZG_08364-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	7.57e-46	58	311	142	395	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	4.58e-37	54	311	95	377	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.54e-35	58	311	130	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.05e-21	55	311	93	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	6.59e-06	74	304	69	274	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000002

TMHMM  Annotations     

Start	End
12	31