CAZyme Information: FOZG_08041-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_08041-t36_1-p1
• CAZy Family: GH152
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491		56707.85	4.7441

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717899.1:4601258-4602733(+)

Full Sequence      

MGSQQFDESIRGALPRDFIWGFATAAAQVEGAWNKDGKGVSIWDTFAHTPGKVKDDSTGD
DAVKSYDLYKTDVEWLRKYNVTGYRFSLSWSRIIPMGGKDDPVNEEGISYYNRLIDELLA
NNITPFVTLFHWDIPQALEDRYGGMLNKDAYTPDFVRYARVCFERFGDRVKDWITYNEPG
VYSLAGYAAGVHAPGRSSFRDRNEEGDSSTEPFIVSHTELVSHAYVADMYKRDFKPTQKG
KIMITLHGNWSEPWDVDDPLDQEAAERAREFEIAWFGDPLYKTGDYPESMREQLGDRLPR
FTPEESKLVLGSSEFYGMNSYSAFYVRHRDGPADINDHLGNVEKLDENKKGEWRGPMGDT
YWLRTTPWGWGKLLRWIWNRYGIPIYITENGTTAQGEHDWKPNGPDDVLEDPFRVDFYKS
YLTEVAKASREGVVIKSYFGWTFTDNWEWAAGFSDRFGATWIDFEAEDKTRYAKRSGYFL
GEFFNHLISRD

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	11	485	3.9e-146	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	3.12e-155	11	483	2	447	Glycosyl hydrolase family 1.
225343	BglB	2.56e-124	13	478	3	444	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	2.76e-103	7	488	21	484	beta-glucosidase
215455	PLN02849	4.82e-103	11	484	27	480	beta-glucosidase
215539	PLN02998	4.11e-94	11	484	28	485	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53715.1|GH1	0.0	1	491	1	491
CCT65005.1|GH1	0.0	1	491	1	491
QGI61314.1|GH1	0.0	1	491	1	491
QGI78494.1|GH1	0.0	1	491	1	491
QGI92212.1|GH1	0.0	1	491	1	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	4.04e-171	13	491	25	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6KHT_A	9.79e-168	13	484	20	488	Chain A, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_B Chain B, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_C Chain C, Glycoside hydrolase family 1 [Trichoderma reesei QM6a]
6EFU_A	9.19e-167	14	491	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	1.85e-166	14	491	3	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	3.53e-166	14	491	22	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	1.96e-160	14	491	11	478	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	2.08e-148	14	488	6	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	6.49e-131	11	486	30	504	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|Q42707|F26G_HELSP	3.93e-130	11	483	93	559	Furostanol glycoside 26-O-beta-glucosidase OS=Hellenia speciosa OX=49577 GN=F26G PE=1 SV=1
sp|Q8L7J2|BGL06_ORYSJ	5.01e-129	11	476	47	511	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOZG_08041-t36_1-p1.