CAZyme Information: FOZG_07917-t36_2-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_07917-t36_2-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
690		77095.97	4.8764

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717899.1:4289268-4291477(+)

Full Sequence      

MAIDFVGNEQETNRLTIDSLITGRPLREIYLKPFEIAVREANPWAVMTSYNLINGVHADL
NKHTLKDILRGEWGYEGTVVSDWGGINSSIESVEAGCDIEFPYSSKWRLDKLVTAVNEGR
ISIEDINQAAENVLTLVERLKGGNMSPEAPEREDDREETRELIRIAGHEGLTLLKNDGGI
LPLCPQSTKVAVIGPNANRHIAGGGGSASLNPYYNTIPLDSIRKVSKQKVSFAQGCHIHK
WLPVASEYCTEQSGKPGVHIDWYAGDKFEGNPVVKQRRTNTDLFLWDSAPLSEVGPEWSA
VATTYLMPRTTGKHTISFMSVGPGKLFINDKLVLDLWDWTEEGEAMFDGSIDYLVDVDME
ADKAVELRVEMTNELRPISKQKQFGITHKYGGCRIGYKEQDQVDYIQQAVQTALDADVAV
VIVGVDAEWESEGYDRQTMDLPADGNQDRLIEAVVKANPKTVVINQSGSPVHMPWVDRVP
VILQGWYQGQEAGNALADVLFGIENPSGKLPSTFPKRIEHTPAWHTWPGENHKVLYGEGL
YIGYRHYDHAKIEPLFPFGHGLSYTTFEYGRPEISTKTLTPDGEIKITLAISNIGARAGA
EIVQLYVHDEKSRLPRPEKELVAFEKVFLEAEETRHITIKLDKYAVGYYDETVPGWIAEE
GAFKVLIGASSTDIRQSTRFNVKESFTWVF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	5	101	1.6e-29	0.4722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	9.57e-73	30	681	236	763	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.06e-58	171	544	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	3.84e-37	5	208	168	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	3.02e-31	14	642	230	743	Probable beta-xylosidase; Provisional
405066	Fn3-like	2.31e-27	601	671	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI61209.1|GH3	0.0	5	690	173	858
QGI78386.1|GH3	0.0	5	690	173	858
QGI92108.1|GH3	0.0	5	690	173	858
CCT64887.1|GH3	0.0	5	690	173	858
QKD53598.1|GH3	0.0	5	675	173	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.18e-135	5	688	148	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.44e-133	5	688	148	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.03e-111	5	687	154	679	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.81e-85	5	674	155	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.21e-76	5	684	165	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	7.41e-150	6	665	157	838	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	1.36e-148	5	674	153	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.34e-144	5	682	145	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	3.35e-144	6	665	157	839	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	9.35e-144	6	665	157	839	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOZG_07917-t36_2-p1.